(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE47

ALIAD_1.PE47         Location/Qualifiers
FT   CDS_pept        complement(58517..61396)
FT                   /locus_tag="Aaci_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG3534"
FT                   /codon_start="1"
FT                   /product="Alpha-L-arabinofuranosidase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: esa:ESA_01942 hypothetical protein"
FT                   /db_xref="GI:258510067"
FT                   /db_xref="GeneID:8423510"
FT                   /translation="MKRPWSAALAALIALGTGASPAWAAAHPSPKVPAGAAGRVRAADV
FT                   VSTPISMEIQVIHDALTVPELAAVQAAAQAASNLSTSQWLQWLYPNATPTTSAQSQAAQ
FT                   AVANLFNLATYGAVSTRGSNAAQILQTLQSISPLLSPRAVGLFYQSFLTEIGQSSKAIL
FT                   ARQASSSIVGNALAQAASLSPTISAYLRQNGLSPSDLARTWSSFETQVDPQGAAQTALA
FT                   TRICTNALGFGAPTASATITVNTAARLRTVPATAFGLNAAVWDSGLNSQTVISEVQALH
FT                   PALIRWPGGSISDVYNWETNTRNDGGYVNPNDTFDNFMQFVNAVGASPIITVNYGTGTP
FT                   QLAADWVKYADVTHHDNVLYWEIGNEIYGNGYYNGNGWEADDHAVPNQPQKGNPGLSPQ
FT                   AYAQNALQFIQAMRAVDPNIKIGAVLTMPYNWPWGATVNGNDDWNTVVLKALGPYIDFV
FT                   DVHWYPETPGQETDAGLLADTDQIPAMVAELKREINAYAGSNAKNIQIFVTETNSVSYN
FT                   PGQQSTNLPEALFLADDLAGFVQAGAANVDWWDLLNGAEDNYTSPSLYGQNLFGDYGLL
FT                   SSGQATPKGVQEPPQYTPLPPYYGFQLVSDFARPGDTLLGSASSQSDIDVHAVREPNGD
FT                   IALMLVNRSPSTIYSADLNVLGVGPYAITKALVYGEGSSAVSPALTLPTAHSVKLMPYS
FT                   GVDLVLHPLIPAPHAAASVTDTLALSSPTVTAGGSETVTASFSSDRPVRDATVELELYD
FT                   STGDLVANHEMTGVDIAPGQPVSESWTFAAPAANGTYTVEAFAFDPATGATYDADTTGA
FT                   TITVNQPPAAKYGDIVTKNTVITVNGTTYTVPAPDASGHYPSGTNISIAPGDTVTIQTT
FT                   FANVSSTDALQNGLIDMEVDGQNGAIFQKYWPSTTLLPGQTETVTATWQVPSSVSAGTY
FT                   PLNFQAFDTSNWTGNCYFTNGGVVNFVVN"
FT                   /protein_id="YP_003183501.1"
     ttgaagagac cttggtctgc tgcgctggcc gcactcatcg cgctgggaac cggcgcgtcg        60
     cccgcgtggg ccgccgccca tccgtcgccg aaagtacctg caggagccgc cggccgcgtg       120
     cgcgccgccg acgtcgtgtc gacgccgatt tcgatggaga tccaggtgat tcatgacgcg       180
     ctcacggtgc ccgagctcgc cgccgtccag gccgcagcgc aggcagcgtc caacctgtcg       240
     acatcgcagt ggctccagtg gctgtatccg aatgccacgc cgacgacgag cgcgcagtcc       300
     caggctgcgc aggccgtcgc caacctgttc aacctggcca catacggcgc tgtatcgacc       360
     cgcgggagca acgccgcgca gattttacag acgcttcagt ccatttctcc cttgctctcg       420
     ccgcgcgccg ttggcctctt ctatcaatcg tttttgaccg agatcggcca atcgtccaaa       480
     gccatcttgg cccgccaagc ctctagctcc attgtcggca acgcgctcgc gcaggccgcg       540
     tcgctctcgc ccaccatctc cgcctacctg cgccagaacg ggctgtctcc gtccgatctc       600
     gcccgcacct ggtcgagctt tgaaacgcag gtcgacccgc agggcgccgc gcagaccgcg       660
     ctcgcgaccc gcatctgcac gaacgcgctc ggcttcggcg cgcccaccgc cagcgccacc       720
     atcaccgtga acactgccgc ccgcctccgg accgttcctg ccaccgcctt tgggctgaac       780
     gcggccgtgt gggacagcgg gctcaactcg cagaccgtca tctccgaggt gcaggcgctc       840
     catcccgcgc tcatccgctg gcccggcggc tccatctcgg acgtgtacaa ctgggagacc       900
     aacacgcgca acgacggcgg ctacgtcaac cccaacgaca cgtttgacaa cttcatgcag       960
     ttcgtgaacg ccgtgggcgc ctcgcccatc atcaccgtca actacggcac cggcacgccc      1020
     cagctcgcgg ccgactgggt caagtacgcc gacgtcaccc atcacgacaa cgtcctatac      1080
     tgggaaatcg gcaacgagat ctacgggaac ggctactaca acggcaacgg ctgggaagcg      1140
     gacgatcacg ccgtcccgaa ccaaccgcag aaaggtaacc ccggcctgag cccgcaggct      1200
     tacgcgcaga acgccctgca gttcatccag gccatgcgcg ccgtcgatcc caacatcaaa      1260
     atcggcgcgg tgctcaccat gccgtacaac tggccctggg gcgccaccgt gaacggcaac      1320
     gacgactgga acacggtcgt gctcaaggcg ctcggcccat acatcgactt cgtcgacgtg      1380
     cactggtacc cggagacccc cggccaggag accgacgccg ggctcctcgc cgacacggat      1440
     cagatccccg ccatggtggc ggagctcaag cgcgagatca acgcgtacgc cggatcgaac      1500
     gcaaaaaata tccaaatctt cgtgaccgag accaacagcg tgtcctacaa cccggggcag      1560
     cagtcgacga atctgcccga ggcactcttt ttggcggacg atctcgccgg cttcgtgcag      1620
     gcgggcgcgg ccaacgtcga ctggtgggac ctcctgaacg gcgccgagga caactacacg      1680
     agtccgagcc tctacggcca gaacctgttt ggcgattacg ggctgctgtc gtccgggcag      1740
     gccacgccca agggcgtcca ggagccgcct caatacaccc cgctgccgcc gtactacggc      1800
     ttccagctcg tgtccgactt cgcgcggccg ggtgacaccc tcctgggctc cgcctcttcc      1860
     cagagcgaca tcgacgtgca cgcggtgcgg gagcccaacg gcgacatcgc cctgatgctc      1920
     gtgaaccgca gtccgtcgac catctacagc gcagatctga acgtgctcgg cgtgggaccg      1980
     tacgccatca ccaaggcgct cgtgtacggc gaaggctcga gcgcggttag cccagcgctg      2040
     acgctgccaa ccgcccactc ggtcaaactc atgccgtaca gcggcgtgga tctcgtcctg      2100
     cacccgctca tccccgcgcc gcacgccgct gcgtcggtga cggacacctt ggcgctctcc      2160
     tcgcctaccg tgaccgccgg cggctccgag accgtcaccg cgtcgttcag ctcggatagg      2220
     cccgtacgcg atgcgacggt ggaactcgag ctgtacgatt cgacgggcga tctcgtcgcg      2280
     aatcacgaaa tgacgggcgt ggatatcgcg ccaggccagc cggtgagcga atcctggacc      2340
     tttgcggccc cggccgccaa cgggacctac accgtcgagg cgttcgcctt cgatccggcc      2400
     acaggcgcca cgtacgacgc cgatacgacg ggcgcgacca tcaccgtgaa tcagcctccc      2460
     gcagccaagt acggcgacat tgtcacaaag aacacggtca tcacggtgaa cggcaccacg      2520
     tacaccgtgc ccgcgcctga cgcaagtggc cactatccgt cgggaaccaa catctccatt      2580
     gcgccgggtg acacggtcac catccagacc acgttcgcca acgtctcgtc gaccgacgcg      2640
     ctccagaacg ggctcatcga catggaggtg gacgggcaaa acggcgctat cttccaaaag      2700
     tactggccga gcaccacgct ccttcccggc cagaccgaga ccgtgaccgc cacctggcag      2760
     gtgccgtcat cggtgagcgc aggcacgtat ccgctcaact tccaggcgtt tgacacgagc      2820
     aactggacgg gcaactgtta cttcaccaac ggcggcgtgg tcaactttgt ggtgaactga      2880
//

If you have problems or comments...

PBIL Back to PBIL home page