(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE48

ALIAD_1.PE48         Location/Qualifiers
FT   CDS_pept        61572..62585
FT                   /locus_tag="Aaci_0049"
FT                   /gene_family="HOG000220180" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LacI family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: aha:AHA_0114 ribose operon repressor"
FT                   /db_xref="GI:258510068"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="GeneID:8423511"
FT                   /translation="MATVKDIARLAGVSPTTVSWALNGKRVSEESLRKVLEAARELNYH
FT                   PKMSARSLRAGKVFSIGFYIVNPSLDPRLNGYLFPMLAGISKVLAEDNYAMQFDIVTPD
FT                   KLDMLAKKALEHSVDGMLVLPQFAGVTERLLKELPEKFPVVYMQQDPAASPDHCVVIDQ
FT                   AAGVELAIRHLYDLGHRAIGVIAGPAEHVDNVLRLRAVQAVFRDLGLSWREEWVAHGQF
FT                   DMESGEVGMRRILEAPDRPTAVFCFNDYMAIGALRAAASAGLRVPDDISILGFDDTDVA
FT                   EASTPALTTIQQPVFQQGQQAAAMLMRLIKGEELPKQVERIRPVVIERSSAERRRA"
FT                   /protein_id="YP_003183502.1"
     GTGGCCACGG TGAAGGACAT CGCGCGGCTG GCCGGGGTGT CGCCCACGAC CGTATCCTGG        60
     GCACTGAACG GCAAGCGCGT GAGCGAGGAG TCGCTGCGCA AAGTGCTCGA AGCCGCGCGC       120
     GAACTCAACT ATCACCCCAA GATGAGCGCT CGAAGTCTGC GCGCGGGCAA GGTGTTTTCC       180
     ATCGGATTTT ACATCGTCAA TCCGAGTCTG GATCCTCGCT TGAACGGCTA TTTGTTTCCC       240
     ATGCTCGCGG GCATTTCGAA GGTCCTCGCC GAGGACAACT ACGCCATGCA GTTCGATATC       300
     GTCACGCCCG ACAAACTCGA TATGTTAGCC AAGAAAGCGC TCGAACATTC TGTCGACGGC       360
     ATGCTCGTGC TGCCCCAGTT CGCGGGCGTG ACGGAGCGGT TGCTGAAGGA GCTGCCCGAG       420
     AAGTTTCCCG TGGTCTACAT GCAACAGGAT CCGGCGGCCA GTCCCGACCA TTGCGTCGTG       480
     ATCGATCAGG CCGCGGGCGT GGAACTCGCC ATTCGACATC TGTACGATCT CGGCCATCGC       540
     GCCATCGGCG TCATCGCAGG CCCCGCAGAA CACGTGGACA ATGTGCTTCG CCTGCGGGCG       600
     GTGCAGGCGG TGTTTCGCGA TCTCGGCCTC AGCTGGCGCG AGGAGTGGGT GGCGCACGGG       660
     CAGTTCGACA TGGAGAGCGG CGAGGTGGGC ATGCGCCGGA TCTTGGAGGC GCCGGATCGC       720
     CCGACGGCGG TCTTCTGCTT CAACGACTAC ATGGCCATCG GCGCGCTGCG CGCGGCGGCG       780
     AGCGCGGGCC TACGGGTCCC AGACGATATC TCCATCCTCG GCTTCGACGA CACGGACGTG       840
     GCGGAGGCGA GCACGCCCGC GCTGACCACC ATTCAGCAGC CGGTGTTTCA GCAGGGCCAG       900
     CAGGCGGCCG CCATGCTCAT GCGGCTCATC AAAGGGGAGG AGTTGCCCAA GCAGGTGGAG       960
     CGCATCCGGC CGGTCGTGAT TGAGCGGTCG TCCGCGGAGC GGAGGCGGGC ATGA            1014
//

If you have problems or comments...

PBIL Back to PBIL home page