(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE50

ALIAD_1.PE50         Location/Qualifiers
FT   CDS_pept        complement(63154..64875)
FT                   /locus_tag="Aaci_0051"
FT                   /gene_family="HOG000239127" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dal:Dalk_2314 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="GI:258510070"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:8423513"
FT                   /translation="MRILDARSPAYKWIALSNTTLGVLMASINGTILIIALPVIFAGIQ
FT                   VNPLQSGQTSLLLWVLMGFNVATTVLLVTFGRLSDMFGRVRLYNLGFLVFTVGSVLCSL
FT                   TWSHGRAGELELIIFRMIQGIGGAFLFSNSAAILTDAFPNNQRGLALGLNQIAAVAGSV
FT                   VGLVLGGILASTGHWRYVFLVNVPIGIIGTVWAYLMLKEMAKPQRDAKLDIPGNATLAL
FT                   GVLALMLALTYGIMPYGGHSMGWTSPMVLALFIGGVVMLGVFGVIERRMPDPLFRLELF
FT                   RIRPFTLGNVALFMGSLARGGLSFMLIIWLQGIYLPLHGVSYENTPLIAGLYTLPQMVG
FT                   FLAAGPLSGYLSDKFGQRAFATGGLLVSAVGFLLLAALPIDFNRFAFWADIFVIGVGMG
FT                   LFASPNNASIMSSVPAQYRGVASGMRSTFNNAGQMMSMGIFFSIVVAGLAAKLPQALVS
FT                   GLTAHGVPVKAAEAIAKLPPTSSLFAALLGYNPLESLLGPNGLNVLSKLPASQVAAITG
FT                   KHFFPTLISPPFHTGLALAFVISAILMVIGAVASIFRGTYQEPQAMSPREAERVAK"
FT                   /protein_id="YP_003183504.1"
     gtgagaattt tggatgcgag aagccctgct tacaagtgga tagcgctctc caacaccacg        60
     cttggcgtgc taatggcttc catcaatggc accattctca tcatcgcgct gccggtcatc       120
     tttgcaggga ttcaggtcaa tccgctgcag agcggccaga cgagtttgtt gctgtgggtc       180
     ctgatgggct tcaacgtggc gacgacggtg ctgctcgtga cgttcggccg attgtccgac       240
     atgttcggcc gcgttcgcct ttacaatttg ggcttcctcg tgttcaccgt cggctctgtc       300
     ctctgctcgc tgacctggag ccacggcagg gcaggagaac tggaactcat cattttccgc       360
     atgatccagg gcattggcgg cgcgttcctc ttttccaaca gcgccgctat tctgaccgac       420
     gcgtttccca acaaccaacg cggtcttgcg cttggcctga accaaattgc agcggtggcg       480
     ggcagcgtcg tgggtctcgt gctgggtggg atcctcgcct cgaccgggca ttggcggtac       540
     gtgttcctcg tcaatgtgcc catcgggatc atcggcaccg tgtgggcgta cctgatgctg       600
     aaggagatgg caaaaccgca gcgcgacgcg aaactcgaca tccccggcaa cgcgaccttg       660
     gccctcggcg tgctggccct gatgctcgcg ctgacctacg gcatcatgcc gtacgggggc       720
     cacagcatgg gctggacatc gccgatggtc cttgcgctct tcatcggcgg cgtggtgatg       780
     ctcggcgtgt tcggcgtgat cgagcggcgc atgccggatc cgctgtttcg cctggagttg       840
     ttccgcattc ggccgttcac gctgggcaac gtggcgctgt tcatgggttc gctcgcgcga       900
     ggtggcctga gcttcatgct catcatctgg ctgcagggga tctacctgcc gttgcacggc       960
     gtgtcgtacg agaacacgcc gctcatcgcg gggctctaca cgctgccgca gatggtggga      1020
     tttctcgccg ccgggccact cagcggttac ctgtccgaca agttcgggca gcgcgccttc      1080
     gccacgggcg gccttctggt gagcgcagtg ggatttttgc tgctcgccgc acttcctatc      1140
     gatttcaacc gctttgcgtt ctgggcggat atcttcgtca tcggcgtggg gatgggactg      1200
     tttgcgtcgc cgaacaacgc ctccatcatg agctccgtgc cggctcagta ccggggcgtg      1260
     gcatccggca tgcgctccac cttcaacaac gcggggcaaa tgatgagcat gggcattttc      1320
     ttctccatcg tggtggccgg actcgcggcg aagctgccgc aggcgctggt gtcggggctc      1380
     acggcgcacg gcgtgcccgt caaggcggcg gaggccatcg cgaaacttcc gcccacctcg      1440
     tcgctcttcg cggcgctcct cgggtacaat ccgctcgaat ccctgctcgg cccaaacggc      1500
     ctgaacgtgc tcagcaagct gcctgcatcg caagtagccg ccatcacggg caagcacttc      1560
     ttcccgacgc tcatctcgcc gcctttccac accggcctcg cgctggcgtt tgtcatctcg      1620
     gcgatcctca tggtgattgg cgcggtggca tcaatatttc gaggcacgta ccaagagcct      1680
     caggccatgt cgccgcgcga agcggagcgc gtcgccaagt ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page