(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE52

ALIAD_1.PE52         Location/Qualifiers
FT   CDS_pept        67339..68322
FT                   /locus_tag="Aaci_0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /codon_start="1"
FT                   /product="phosphate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphate transporter; KEGG: dar:Daro_0679
FT                   phosphate transporter"
FT                   /db_xref="GI:258510072"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="GeneID:8423515"
FT                   /translation="MSVLLAYALLAIFAALSGLNDGGNLLAVLSSSRILPVAVVIAEMG
FT                   TCMLAAPFLVGTRVAHTIGAGILPLPELSLPVVTAALVATLVTLAACYLSNVPTSITFA
FT                   LVGAMGGVGAVMLGMNRVHWASVGRVAGSLVMSVVLAGAAGYAAHFAARVLLGRVSARA
FT                   GRAALWTEIATSACVCIGYGANDAEKTLGLLALVTGVSHHHGTFHVAPWMVGFSTAAFL
FT                   VGLLVGGWRVARTIQGHVFRIRPIHAVMNEFATAAVVIAASSLGGPVSTTQALDSSLVG
FT                   VGASAHARRVRWRVVRKMAGVWLMTMPLAFLVGCVTGQLFVWGGYR"
FT                   /protein_id="YP_003183506.1"
     ATGAGTGTGC TCTTGGCATA TGCTCTCTTA GCTATCTTTG CGGCTCTCTC CGGATTGAAC        60
     GACGGAGGCA ATTTGCTCGC TGTGCTCTCG AGTTCGCGAA TTCTGCCTGT GGCGGTCGTG       120
     ATCGCCGAGA TGGGCACGTG CATGCTTGCG GCTCCGTTCC TCGTCGGAAC ACGCGTGGCG       180
     CACACCATTG GCGCGGGGAT CCTGCCGCTT CCCGAACTCA GCCTGCCAGT GGTGACGGCG       240
     GCGCTCGTGG CGACGCTCGT GACGCTGGCC GCCTGTTATT TGTCAAACGT GCCTACGAGT       300
     ATCACGTTCG CGCTCGTGGG CGCGATGGGC GGTGTCGGCG CGGTGATGCT TGGTATGAAT       360
     CGGGTTCACT GGGCGAGCGT CGGGCGAGTG GCTGGATCGC TCGTCATGAG CGTGGTGTTG       420
     GCAGGGGCTG CGGGATACGC GGCTCACTTC GCCGCCAGGG TCCTCCTGGG ACGTGTGTCG       480
     GCGCGAGCGG GACGGGCGGC GCTTTGGACG GAGATAGCGA CATCCGCTTG CGTATGCATA       540
     GGATACGGCG CAAACGATGC GGAGAAGACG CTGGGACTTT TGGCGCTCGT GACGGGCGTG       600
     TCGCATCATC ACGGCACATT TCACGTGGCG CCGTGGATGG TCGGGTTCTC GACCGCGGCC       660
     TTTCTGGTGG GACTGCTCGT CGGCGGCTGG CGCGTGGCTC GCACCATTCA GGGCCACGTC       720
     TTTCGCATCC GGCCCATTCA CGCCGTCATG AATGAATTTG CCACCGCGGC CGTCGTGATC       780
     GCGGCCTCAA GCCTGGGCGG GCCGGTGAGC ACGACGCAGG CGCTCGACAG CTCGCTCGTG       840
     GGTGTGGGGG CGAGCGCGCA CGCGCGGCGG GTGCGGTGGC GCGTGGTGCG GAAGATGGCC       900
     GGGGTGTGGC TCATGACCAT GCCGCTGGCG TTTCTCGTCG GATGTGTGAC GGGACAACTG       960
     TTTGTTTGGG GGGGATATCG ATGA                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page