(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE54

ALIAD_1.PE54         Location/Qualifiers
FT   CDS_pept        69155..70660
FT                   /locus_tag="Aaci_0055"
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /codon_start="1"
FT                   /product="glycerol kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; KEGG: hha:Hhal_0078 glycerol kinase"
FT                   /db_xref="GI:258510074"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="GeneID:8423517"
FT                   /translation="MDARTFILAFDQGTTSSRAILFDRAGRIHSIAQKEFTQIYPKPGW
FT                   VEHDPMEIWGTQSGVAREVLEKAAVSPEQVAAIGITNQRETTVVWDKETGKPVYNAIVW
FT                   QDRRTADICDELKAAGHADAIRDKTGLVIDAYFSGTKIKWILDHVEGARERAERGELLF
FT                   GTIDTWLVWNLTRGKVHVTDYTNASRTMLFNIHTLDWDDDLLKLLGIPRAMLPEVRPSS
FT                   SIYGHTDEHTFGGANIPIAGIAGDQQAALFGQTCFEPGMVKNTYGTGCFMLMNTGEKPV
FT                   ASPSGLLTTIAWGLDGKVTYALEGSVFIAGAAIQWLRDGLRFFDAAADSEYFASKVEDT
FT                   GGVYVVPAFAGLGAPYWDMYARGAIFGLTRGTRKEHIIRATLDSLAYQTKDILDAMQRD
FT                   SGIELKSLRVDGGAVANNLLMQFQADILGVPVERPRITESTALGAAYLAGLAVGFWSKD
FT                   EIARSGDIERRFDPQMDAETRARLYRGWQRAVERTMGWAQEDI"
FT                   /protein_id="YP_003183508.1"
     ATGGACGCTC GAACGTTTAT CCTCGCCTTC GACCAAGGCA CAACCAGCTC CCGCGCGATT        60
     CTGTTCGATC GCGCCGGGCG CATTCACAGC ATCGCCCAGA AGGAGTTCAC CCAGATCTAT       120
     CCGAAGCCCG GCTGGGTCGA ACATGACCCG ATGGAGATCT GGGGCACGCA GAGCGGCGTC       180
     GCGCGAGAGG TGCTCGAGAA GGCCGCCGTG TCCCCGGAAC AGGTGGCGGC CATCGGGATC       240
     ACCAACCAGC GCGAGACCAC GGTGGTGTGG GACAAGGAGA CCGGCAAGCC TGTCTACAAC       300
     GCCATCGTCT GGCAGGATCG CCGCACGGCC GATATCTGCG ATGAGCTGAA GGCGGCCGGT       360
     CACGCCGATG CCATCCGCGA CAAGACGGGC CTTGTCATCG ACGCCTACTT CTCCGGCACG       420
     AAGATCAAAT GGATTCTCGA TCACGTCGAG GGCGCCCGCG AGCGCGCCGA GCGAGGAGAG       480
     TTGCTTTTCG GTACCATCGA CACCTGGCTT GTGTGGAACC TGACGCGCGG CAAGGTCCAC       540
     GTGACGGACT ACACGAACGC GTCGCGCACG ATGCTCTTCA ACATTCACAC GCTCGATTGG       600
     GACGACGATC TCCTCAAGCT GCTCGGCATC CCGCGCGCCA TGCTGCCTGA GGTCCGGCCC       660
     TCCTCGTCCA TCTACGGCCA CACCGATGAA CACACGTTTG GCGGCGCGAA CATTCCCATC       720
     GCCGGGATCG CAGGAGATCA ACAGGCGGCG CTCTTTGGGC AGACGTGCTT CGAACCGGGT       780
     ATGGTCAAGA ACACGTACGG CACCGGCTGC TTCATGCTCA TGAACACAGG CGAGAAGCCC       840
     GTGGCGTCGC CGTCCGGGCT GCTGACGACC ATTGCCTGGG GGCTCGACGG CAAAGTCACG       900
     TATGCGCTTG AGGGAAGCGT CTTCATCGCG GGCGCAGCGA TTCAGTGGCT GCGCGACGGG       960
     CTGCGCTTCT TCGATGCGGC GGCCGACTCG GAATACTTTG CGAGCAAGGT GGAGGACACA      1020
     GGCGGCGTGT ACGTTGTGCC GGCGTTCGCC GGCCTCGGTG CGCCGTATTG GGACATGTAC      1080
     GCTCGCGGCG CCATCTTCGG CTTGACACGC GGAACCCGCA AGGAGCACAT CATCCGCGCT      1140
     ACGCTCGATT CGCTCGCGTA CCAGACGAAA GACATCCTCG ACGCGATGCA GAGGGACTCT      1200
     GGCATCGAGC TCAAATCGCT CCGGGTCGAT GGCGGCGCGG TGGCGAACAA CCTGCTCATG      1260
     CAGTTCCAGG CGGACATTCT CGGCGTGCCG GTGGAGCGGC CGCGGATCAC CGAGTCCACG      1320
     GCGCTTGGCG CGGCGTATCT CGCCGGGCTC GCGGTGGGGT TCTGGTCCAA GGACGAGATC      1380
     GCCCGGAGCG GAGACATCGA GCGCCGTTTC GATCCACAGA TGGACGCGGA AACACGGGCG      1440
     CGCCTGTATC GCGGATGGCA GCGCGCCGTG GAGCGCACGA TGGGTTGGGC GCAGGAGGAC      1500
     ATCTGA                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page