(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE55

ALIAD_1.PE55         Location/Qualifiers
FT   CDS_pept        70814..72508
FT                   /locus_tag="Aaci_0056"
FT                   /gene_family="HOG000004812" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mxa:MXAN_7329 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="GI:258510075"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:8423518"
FT                   /translation="MAEGRFSIAARSAIKAEMAGEPLDLLIIGGGITGAGILLDATARG
FT                   MKAALVEMQDFAAGTSNRSTKLVHGGLRYLKQFEVGLVAEVGKERAIVYENGPHITTPV
FT                   WMLLPIIEGGTYGWLATSVGIYIYDKLAGVKRSERRKMLSAEQALEIEPLLRREGLKGA
FT                   GYYVEYRTDDARLTLEILKKAVEMSGLALNYAKATGFLYDHGRVAGAEVEDVLSGETFI
FT                   VRAKKVVNATGPWVDELREKDGSKSGKTLHHTKGVHIVVDGKRFPLRNSVYFDVPDGRM
FT                   VFAIPRDGKTYIGTTDTDYHGDLVHPRMTKADRDYLIDCVNSMFPSVKLTAADIESSWA
FT                   GVRPLIHEEGKDPSEISRKDEVFVSPSGLLTIAGGKLTGYRKMAEKVVDMVARDLAEDG
FT                   RRFGPCTTDKIPYSGGDFGGSDKMPAFVEDRVQRGVKLGLAEEDARRLARRYGTNVDLV
FT                   FNLLASGRDRAEAHGLRLDVYAELEYGLRHEMVATPSDFFIRRTGALYFDIDWVRENQN
FT                   AVIRYMAAACGWSEEETERHARELQARVLEATTVEEDIPASGNLVGA"
FT                   /protein_id="YP_003183509.1"
     ATGGCGGAGG GGCGGTTTTC GATCGCGGCG AGATCGGCCA TCAAAGCAGA GATGGCCGGC        60
     GAGCCGTTGG ATCTGCTCAT CATCGGCGGC GGCATCACGG GGGCGGGCAT CCTGCTCGAT       120
     GCGACGGCGC GGGGCATGAA GGCGGCCCTC GTCGAGATGC AGGACTTCGC CGCAGGCACG       180
     TCCAATCGGT CGACGAAGCT CGTGCACGGC GGCCTGCGGT ATCTGAAGCA GTTTGAGGTG       240
     GGGCTTGTGG CCGAAGTGGG CAAGGAACGC GCCATCGTCT ACGAGAACGG CCCGCACATC       300
     ACGACGCCCG TGTGGATGCT GTTGCCCATC ATCGAGGGCG GCACGTACGG GTGGCTGGCG       360
     ACGAGCGTGG GCATCTACAT CTACGACAAG CTCGCGGGCG TCAAGCGATC CGAGCGGCGC       420
     AAGATGCTGA GCGCCGAGCA GGCGCTTGAG ATCGAGCCGC TGCTGCGCCG AGAGGGACTG       480
     AAGGGCGCCG GCTATTATGT CGAATACCGG ACGGACGACG CGCGCCTCAC GCTTGAGATT       540
     CTGAAGAAGG CGGTGGAGAT GAGCGGGCTT GCGCTCAACT ACGCGAAGGC CACCGGCTTC       600
     CTCTACGATC ACGGCCGCGT CGCGGGTGCC GAGGTCGAAG ACGTGCTCTC CGGCGAGACT       660
     TTCATCGTTC GGGCGAAGAA GGTCGTCAAC GCCACCGGCC CCTGGGTCGA TGAACTCCGG       720
     GAGAAGGACG GATCGAAATC CGGCAAGACG CTGCACCACA CCAAGGGCGT GCACATCGTG       780
     GTGGATGGCA AGCGGTTTCC GCTGCGCAAT TCCGTGTACT TCGACGTGCC CGATGGGCGC       840
     ATGGTCTTCG CCATTCCGCG CGACGGCAAG ACCTACATCG GCACCACCGA CACGGATTAC       900
     CACGGCGATC TCGTCCATCC GCGCATGACC AAGGCGGATC GCGATTATCT CATCGACTGC       960
     GTGAACTCCA TGTTCCCAAG CGTCAAGCTG ACGGCGGCGG ACATCGAGAG CAGTTGGGCG      1020
     GGCGTTCGGC CGCTCATCCA CGAGGAAGGC AAAGATCCGT CCGAGATCTC GCGCAAGGAC      1080
     GAGGTGTTTG TCTCGCCGTC CGGGCTTCTC ACCATCGCGG GTGGCAAGCT CACCGGCTAC      1140
     CGCAAGATGG CCGAGAAGGT GGTCGACATG GTGGCGCGCG ATCTCGCCGA AGACGGCCGG      1200
     CGCTTCGGAC CGTGCACCAC GGACAAGATC CCGTATTCGG GCGGGGATTT CGGCGGATCG      1260
     GACAAGATGC CGGCGTTTGT CGAGGATCGC GTGCAGCGCG GCGTGAAGCT CGGCCTGGCG      1320
     GAGGAGGACG CGAGGCGCCT CGCCCGCCGC TATGGCACCA ACGTCGATCT CGTCTTCAAC      1380
     CTGCTCGCGT CCGGGCGCGA TCGCGCAGAG GCGCATGGGC TGAGGCTGGA TGTGTACGCG      1440
     GAATTGGAGT ACGGCCTGCG GCACGAGATG GTGGCGACGC CGTCCGACTT CTTCATCCGT      1500
     CGGACGGGCG CGCTGTACTT CGACATCGAC TGGGTGCGGG AGAACCAGAA CGCCGTCATC      1560
     CGGTACATGG CGGCGGCGTG CGGCTGGAGC GAAGAAGAAA CCGAGCGGCA CGCGCGGGAA      1620
     CTCCAAGCGC GCGTGCTGGA GGCAACCACG GTGGAAGAAG ACATCCCCGC ATCGGGCAAT      1680
     CTCGTGGGGG CGTGA                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page