(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE56

ALIAD_1.PE56         Location/Qualifiers
FT   CDS_pept        72699..74579
FT                   /locus_tag="Aaci_0057"
FT                   /gene_family="HOG000086348" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /codon_start="1"
FT                   /product="Peptidase S53 propeptide"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase S53 propeptide; peptidase S8 and S53
FT                   subtilisin kexin sedolisin; KEGG: cvi:CV_3519 periplasmic
FT                   aspartyl protease"
FT                   /db_xref="GI:258510076"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="GeneID:8423519"
FT                   /translation="MGLWKRLAFGLPAALGMLAVGVPTMDADAVQAAPLANPSTENAQD
FT                   LGPANASQTVTASVILHVQNPTALQNYIQQTETPGSAQYHKFLTTSQFAAQFAPSDQTI
FT                   QQIEQELEQYGLQVVNVSADHLDLQVQGTIQQFDHAFNTVIDLFKANGQVFRAPKKPPQ
FT                   IPVALLTNVLAVVGLDTANAAQSLTVKTPHVSGMPSPKAVLPQGGSTATGTPGSYTVGD
FT                   TANRYDVNPLYQKGITGKGETVGIVTLSSFNPQDAYTYWKGIGLHVAQNRIQMVNVDGG
FT                   GQMDDGSVETALDVEQAGGIAPDANVVVYDAPNTDQGFIDAFYQAVSDNQVDSLSVSWG
FT                   QPEIDYLPQMNQGQSYVDELLAFTQAFMEAAAQGISVYAAAGDSGAYDTARDFPPSQGF
FT                   STPLTVDFPASDPFVTAAGGTTVPFSATFSLGKVNITQEQPWSWQYLQNLGYQGLFPIG
FT                   TGGGVSVIFPRPWYQNGVSGVQNSAANQAFTDSQGVLYGSPFTYNLPSNYPGRNLPDVS
FT                   MDADPETGYLVYWSAGGGWLAGYGGTSFVAPQLNGITALIDQYVGGRVGFLDPVFYQLM
FT                   QQNGYGANQPFNDLTTGNNWYWSAVPGYDRASGIGTPNVANLAQAIKSMG"
FT                   /protein_id="YP_003183510.1"
     GTGGGACTGT GGAAAAGACT GGCTTTTGGG CTCCCGGCCG CGCTCGGCAT GCTGGCCGTC        60
     GGGGTGCCGA CCATGGACGC GGACGCTGTG CAGGCGGCGC CGCTCGCGAA TCCGTCGACG       120
     GAAAATGCGC AAGATCTGGG GCCTGCCAAC GCGAGTCAGA CCGTCACGGC GTCGGTCATT       180
     CTGCACGTGC AGAACCCGAC GGCTTTGCAG AACTATATCC AGCAGACGGA GACGCCGGGC       240
     AGCGCGCAGT ATCACAAGTT TTTGACGACG AGCCAATTTG CCGCGCAGTT CGCGCCGTCG       300
     GATCAGACCA TCCAGCAAAT CGAGCAGGAG CTTGAGCAGT ACGGCCTGCA GGTGGTGAAC       360
     GTCAGCGCGG ATCACCTGGA TCTCCAGGTG CAAGGGACCA TCCAGCAGTT TGATCACGCG       420
     TTCAACACCG TGATCGACCT GTTCAAGGCA AACGGCCAGG TGTTCCGCGC GCCGAAGAAG       480
     CCGCCGCAGA TTCCGGTGGC GCTCCTCACC AACGTGCTCG CGGTGGTGGG CCTCGATACG       540
     GCGAACGCGG CGCAGTCGCT CACCGTAAAG ACGCCGCATG TGTCGGGGAT GCCGTCTCCT       600
     AAAGCGGTGC TGCCGCAAGG AGGCAGCACG GCGACGGGCA CGCCGGGGAG CTACACCGTC       660
     GGCGATACGG CGAACCGGTA CGACGTCAAT CCGCTCTATC AAAAAGGCAT CACCGGCAAG       720
     GGCGAGACAG TCGGCATTGT CACGCTTTCG AGCTTTAACC CACAGGACGC CTACACCTAC       780
     TGGAAGGGCA TCGGGCTGCA CGTCGCGCAA AACCGCATTC AGATGGTGAA CGTCGACGGC       840
     GGCGGGCAGA TGGACGATGG GTCGGTCGAG ACGGCGCTCG ACGTCGAGCA GGCGGGGGGC       900
     ATCGCGCCAG ACGCCAACGT CGTGGTGTAC GACGCGCCCA ATACGGATCA GGGCTTTATC       960
     GACGCGTTCT ACCAAGCGGT CTCCGACAAC CAGGTGGACT CCTTGTCCGT GAGCTGGGGG      1020
     CAGCCGGAGA TCGACTATTT GCCTCAGATG AACCAGGGCC AGTCGTACGT CGACGAGCTG      1080
     CTCGCCTTCA CACAGGCGTT CATGGAGGCG GCGGCACAGG GCATCTCCGT CTATGCTGCC      1140
     GCCGGAGATT CGGGTGCGTA CGATACCGCT CGCGATTTCC CGCCCTCGCA GGGATTCTCC      1200
     ACGCCTCTGA CGGTTGACTT CCCGGCGTCG GATCCGTTCG TCACGGCCGC GGGTGGCACG      1260
     ACGGTACCGT TTTCCGCCAC GTTTTCGCTC GGCAAAGTCA ACATCACGCA GGAGCAGCCG      1320
     TGGTCGTGGC AGTATTTGCA GAATCTCGGC TATCAAGGCC TGTTCCCCAT CGGGACAGGC      1380
     GGCGGCGTGA GCGTCATCTT CCCGCGCCCG TGGTATCAAA ATGGCGTGAG CGGCGTCCAG      1440
     AACAGCGCGG CCAACCAGGC CTTCACCGAC TCGCAGGGCG TGCTGTACGG CTCTCCCTTC      1500
     ACCTACAACC TGCCAAGCAA CTACCCGGGC CGCAACCTGC CGGACGTCTC GATGGACGCG      1560
     GATCCGGAGA CGGGCTATCT CGTGTACTGG AGCGCAGGGG GCGGCTGGCT GGCGGGCTAC      1620
     GGTGGCACGA GCTTTGTGGC GCCGCAGCTG AACGGCATCA CGGCGCTCAT CGATCAGTAC      1680
     GTCGGCGGCC GAGTCGGATT CCTCGACCCG GTCTTCTACC AACTCATGCA GCAGAATGGG      1740
     TACGGCGCGA ATCAGCCGTT CAACGACTTG ACGACGGGGA ACAACTGGTA TTGGTCCGCG      1800
     GTGCCCGGGT ACGATCGGGC CTCCGGAATT GGCACGCCGA ACGTCGCCAA CCTGGCGCAG      1860
     GCCATCAAGT CGATGGGTTG A                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page