(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE57

ALIAD_1.PE57         Location/Qualifiers
FT   CDS_pept        74711..75415
FT                   /locus_tag="Aaci_0058"
FT                   /gene_family="HOG000273994" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: sde:Sde_1768
FT                   GntR family transcriptional regulator"
FT                   /db_xref="GI:258510077"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:8423520"
FT                   /translation="MIAGVTYGVAKKTLGEQAYEVIREEILSLRLHPGQTVYESDFTRM
FT                   LNMSRTPVREAVRALAMERLIEVLPQRGMKVALISERQVEETRFVRESLELSVIRRVAE
FT                   DVAQDASVRARLEREMARSLQDQREAAEAGDALQFMHADDAFHQIFLQHFDNETLTAIV
FT                   AQMRGHLNRVRMLSLFEPERMKRLVGEHERVAEAVLSGNADRSAEAMHHHLAKLMEDLP
FT                   GIKARHPAFFGP"
FT                   /protein_id="YP_003183511.1"
     GTGATCGCGG GTGTGACCTA CGGTGTGGCC AAAAAGACGC TCGGAGAACA GGCGTACGAG        60
     GTCATCCGCG AGGAGATCTT GTCGCTTCGG CTGCATCCGG GGCAGACGGT GTACGAGTCG       120
     GACTTCACGC GCATGTTGAA CATGAGCCGC ACGCCGGTGC GCGAAGCGGT GCGCGCGCTT       180
     GCGATGGAGC GGCTCATTGA GGTGCTGCCC CAGCGGGGCA TGAAGGTGGC TTTGATTTCG       240
     GAGCGGCAGG TGGAAGAGAC CCGATTCGTC CGGGAGAGCC TGGAGCTTTC GGTCATCCGC       300
     CGCGTCGCGG AGGACGTCGC GCAGGATGCG TCGGTCCGCG CCCGGCTGGA GAGGGAGATG       360
     GCGAGATCGC TCCAAGATCA GCGGGAGGCG GCCGAAGCGG GGGACGCGCT TCAATTTATG       420
     CACGCGGACG ATGCGTTTCA CCAGATTTTT CTGCAGCACT TCGACAATGA GACGCTCACG       480
     GCCATCGTGG CGCAGATGCG TGGGCATCTC AACCGGGTGC GGATGTTGTC GCTGTTCGAG       540
     CCCGAGCGGA TGAAGCGGCT CGTCGGGGAG CACGAGCGCG TCGCCGAGGC CGTGCTTTCG       600
     GGCAATGCCG ACCGGTCCGC GGAGGCGATG CATCATCACC TGGCGAAGCT GATGGAGGAT       660
     CTGCCAGGGA TCAAAGCCCG GCATCCGGCG TTCTTTGGCC CCTGA                       705
//

If you have problems or comments...

PBIL Back to PBIL home page