(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE6

ALIAD_1.PE6          Location/Qualifiers
FT   CDS_pept        6202..8664
FT                   /locus_tag="Aaci_0006"
FT                   /gene_family="HOG000076279" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: gur:Gura_0005 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="GI:258510026"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="GeneID:8423464"
FT                   /translation="MADESSSRGILPVDISQELRNSFLDYAMSVIVARAIPDVRDGLKP
FT                   VHRRILYAMYEAGMTPDKPYKKSSRIVGDVLGKFHPHGDAAVYEALVRLAQDFSTRYPL
FT                   IDGHGNFGSIDGDAAAAMRYTESRMSAIALELLRDINKETVDFIPNYDEQEEEPVVLPS
FT                   RFPNLLVNGSSGIAVGMATNIPPHNLREVIDGVVMLIDHPDATLDDLMTVIKGPDFPTG
FT                   GVILGREGIRKAYETGRGSITVRAVTHFEELSGGKTRIVVTEIPYQQNKARIVEKIAEL
FT                   AREKKIDGITDLRDESDRRGMRVVIELRRDVRPQVVLNNLFKHTALQTSFGVINLALVN
FT                   GEPKVLTLRETLEHYLNHQRDVVRRRTQYDLAKAEARAHILEGLRIALDHLDEVISLIR
FT                   SSRTVDEARQGLISTFGLSEEQAQAILDMRLQRLTGLEREKIEAEYQELQQRIAELKAI
FT                   LADPKLLDGVIRQEILEIKERFGDERRTRIVNAEGEISEEDLIPVHDVVIAITHRGYIK
FT                   RLPLSTYHSQRRGGRGMTLINAHEEDFVTGLHVTSTHDYLLFFTNRGRMYAIKAYDVPE
FT                   FGRQARGTPIVNLLNIEQGEKVTAMIPVKSLDPAEIGDTYLFFATRQGIVKKTPLAEYS
FT                   NVRKNGLIAINLRDDDDLVGVKLTDGTKEIMMVTRNGLAIRFPETDVRPMGRAATGVKG
FT                   ISLSEGDEVIAMDVAEDDHDVLVVTSRGYGKRTPVSEYRAQSRGGKGIKTLNCTPKNGH
FT                   AIEMCMVTEDDDVMIVTQAGVAIRIHVRDVSTLSRNTQGVRLINVDEGVEVASVSRVVK
FT                   DDDEDSEP"
FT                   /product="DNA gyrase, A subunit"
FT                   /protein_id="YP_003183460.1"
     ATGGCAGACG AGAGCAGCTC TCGCGGCATC TTGCCGGTGG ATATCAGCCA GGAGCTGCGC        60
     AATTCGTTTC TTGATTACGC GATGAGCGTC ATCGTCGCTC GGGCCATTCC GGACGTGCGC       120
     GACGGCCTGA AGCCTGTGCA TCGGCGCATC CTGTACGCGA TGTACGAGGC AGGCATGACG       180
     CCGGACAAGC CGTACAAGAA GTCGTCGCGC ATCGTCGGCG ACGTGCTGGG TAAGTTCCAC       240
     CCGCACGGCG ACGCCGCGGT GTACGAGGCC TTGGTGCGGC TGGCGCAGGA TTTTTCCACG       300
     CGTTATCCGC TCATCGACGG GCACGGAAAC TTCGGATCCA TCGACGGCGA TGCGGCCGCG       360
     GCGATGAGGT ACACCGAGTC GCGCATGTCC GCCATCGCGC TTGAACTCCT GCGGGACATC       420
     AACAAGGAGA CGGTCGATTT CATTCCCAAC TACGACGAGC AGGAAGAAGA GCCCGTCGTC       480
     CTGCCGTCCC GCTTCCCGAA CCTTCTCGTC AACGGATCGA GCGGTATCGC CGTCGGCATG       540
     GCGACGAACA TCCCGCCGCA CAACCTGCGC GAGGTGATCG ACGGCGTCGT CATGCTGATC       600
     GACCATCCGG ACGCGACGCT CGACGACCTG ATGACGGTCA TCAAGGGTCC GGACTTTCCG       660
     ACGGGCGGCG TCATCTTAGG CCGCGAGGGC ATTCGAAAGG CCTACGAAAC GGGCCGCGGT       720
     TCCATCACGG TGCGCGCGGT CACGCACTTC GAGGAGCTTT CCGGCGGCAA GACGCGCATC       780
     GTGGTGACGG AGATCCCGTA TCAGCAGAAC AAGGCGCGCA TCGTGGAGAA GATCGCGGAA       840
     CTCGCGCGCG AGAAGAAGAT CGACGGCATC ACGGATCTCC GCGACGAGAG CGATCGGCGC       900
     GGCATGCGCG TCGTGATCGA GCTGCGCCGC GACGTGCGCC CGCAGGTGGT GCTGAACAAC       960
     CTGTTCAAGC ACACGGCCCT GCAGACGAGC TTCGGCGTCA TCAATTTGGC GCTCGTGAAC      1020
     GGCGAGCCGA AGGTGCTCAC GCTTCGCGAG ACGCTCGAAC ACTATCTGAA TCATCAGCGA      1080
     GACGTCGTTC GCCGCAGGAC GCAGTACGAT CTCGCCAAAG CCGAGGCGCG CGCCCACATC      1140
     CTGGAGGGCC TGCGTATCGC ACTCGATCAC CTGGACGAGG TCATCTCGCT CATCCGAAGC      1200
     TCACGCACCG TCGACGAGGC GCGCCAGGGG CTCATCTCGA CGTTCGGGCT GTCGGAGGAG      1260
     CAGGCCCAGG CCATCCTGGA CATGCGCCTG CAGCGGCTGA CGGGCCTCGA GCGGGAGAAG      1320
     ATTGAGGCGG AGTATCAGGA GTTGCAGCAG CGCATCGCCG AGCTCAAAGC CATCCTCGCC      1380
     GATCCGAAGC TCTTGGACGG CGTGATCCGG CAGGAGATCC TGGAGATCAA GGAGCGGTTC      1440
     GGCGACGAGC GGCGCACGCG GATCGTGAAC GCCGAGGGCG AGATCAGCGA AGAGGATCTC      1500
     ATCCCGGTGC ACGACGTCGT GATCGCCATC ACCCACCGCG GCTACATTAA GCGGCTGCCG      1560
     CTCTCCACGT ACCACAGTCA GCGCCGCGGC GGGCGGGGGA TGACGCTCAT CAACGCGCAC      1620
     GAGGAAGACT TCGTGACCGG GCTGCACGTG ACGTCGACGC ACGACTACTT GCTCTTCTTC      1680
     ACGAACCGCG GCCGCATGTA CGCCATCAAG GCCTACGACG TGCCCGAGTT CGGCCGGCAG      1740
     GCGCGCGGAA CGCCCATCGT GAACCTGCTC AACATCGAGC AGGGCGAGAA GGTCACCGCG      1800
     ATGATCCCGG TGAAGTCGCT CGATCCGGCC GAGATCGGCG ATACGTACCT GTTTTTCGCC      1860
     ACGCGCCAGG GCATCGTGAA GAAGACGCCG CTCGCCGAGT ACTCGAACGT GCGCAAGAAC      1920
     GGGCTCATCG CCATCAACCT TCGCGACGAC GACGACCTCG TCGGCGTGAA GCTGACGGAC      1980
     GGCACGAAGG AGATCATGAT GGTCACGCGC AACGGGCTCG CCATCCGCTT CCCGGAGACC      2040
     GATGTGCGCC CGATGGGCCG CGCCGCGACC GGGGTCAAGG GCATCTCGCT CAGCGAAGGC      2100
     GACGAAGTCA TTGCGATGGA TGTGGCGGAG GACGATCACG ACGTGCTCGT CGTCACGTCC      2160
     CGCGGCTACG GCAAGCGCAC GCCGGTGAGC GAGTATCGCG CGCAGTCGCG CGGCGGCAAG      2220
     GGCATCAAGA CGCTCAACTG CACGCCGAAG AACGGGCATG CCATCGAGAT GTGCATGGTG      2280
     ACGGAAGACG ACGACGTGAT GATCGTGACG CAGGCCGGCG TGGCCATCCG CATCCACGTG      2340
     CGCGACGTGT CCACCCTGAG CCGGAACACG CAGGGCGTGC GGCTCATCAA CGTCGACGAA      2400
     GGCGTCGAGG TGGCCTCCGT CAGCCGCGTG GTCAAGGATG ACGACGAGGA TTCGGAGCCG      2460
     TGA                                                                    2463
//

If you have problems or comments...

PBIL Back to PBIL home page