(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE62

ALIAD_1.PE62         Location/Qualifiers
FT   CDS_pept        complement(80621..80833)
FT                   /locus_tag="Aaci_0063"
FT                   /gene_family="HOG000262994" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_2428"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_2428 hypothetical protein"
FT                   /db_xref="GI:258510082"
FT                   /db_xref="GeneID:8423525"
FT                   /translation="MNDTQKPSTKAKRWWYLLILAPVIGSLFPGLYGSLKPELWGIPYF
FT                   YWYQMLWIIIAAIITAFLYNILKDD"
FT                   /protein_id="YP_003183516.1"
     gtgaacgaca cgcagaagcc gtccacgaaa gcgaagcggt ggtggtacct gctcatcctc        60
     gcacccgtca tcggatcgct gtttccgggc ctgtacggat cgctcaagcc ggagttgtgg       120
     ggcatcccgt acttctactg gtaccagatg ctctggatca tcatcgcggc catcatcacc       180
     gcatttttgt acaacatcct caaggacgac tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page