(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE63

ALIAD_1.PE63         Location/Qualifiers
FT   CDS_pept        complement(81071..82765)
FT                   /locus_tag="Aaci_0064"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: dma:DMR_19620 sensor protein ZraS; TIGRFAM:
FT                   PAS sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold domain protein; PAS fold-4 domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein"
FT                   /db_xref="GI:258510083"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:8423526"
FT                   /translation="MNHDFRRAYPYALLAIGLTVPFCAAWGLYGQTQSLLWILIAVACG
FT                   LEFFPLQLPGGRQWSTSVFCYVWAADQFGFWAASTTILFSVIAAFLRSVDGKLTGAHLR
FT                   RLLISLGTHQLALVPAYAALRHALFLPYLIRSALAAVLFELARLTALACFHGSMRRLGA
FT                   AFGALRGLHPAALLIPASLASLLSAHEADWAVTLPTAALFLSFLWLSRAHARLADECES
FT                   ARQTYRVIAENSADLVLIAAPSGEITFASPGFLASAGLSRESLVGRSVFDLVAPEDFAR
FT                   FDELFTPAGADGQEHDVALEIDDVRVNVALRLTLIRSGTHSPSYILQARDLAPRLRREA
FT                   SRLRDERLEAVGQLAASIAHEFRNPLTTVMGFVQLFRSQFDELAPGAYEAIWGELERMK
FT                   DVTDSLMVLARPEAFKPIPCDLAEMARAAIGACEPLALERGVPVDLGPLPPAQVLGHPG
FT                   QLRQMMVHLLRNAIEAAAETRGRVVLWVTSTEAEAIVHIQDTGPGIPDSVLEHLGEPLY
FT                   HTKEKGTGLGLMVVHRIVQQHGGQIHIRRTEAPIGTAVEVRLPISRR"
FT                   /protein_id="YP_003183517.1"
     ttgaaccacg attttcgccg cgcctatccc tacgccctgc tcgccattgg gctcacggtg        60
     cccttctgcg cagcctgggg cttgtacgga cagacccaaa gccttctgtg gatcctcatc       120
     gccgtcgcgt gcgggctgga attcttcccc ctccagcttc ccggcgggcg gcagtggtcc       180
     acgtccgtct tctgctatgt gtgggcggcc gatcaattcg gtttctgggc ggcgagcacc       240
     accatcttgt tcagcgtcat cgcggcattc cttcgttctg tcgacggcaa gctcacgggc       300
     gcacacctga ggcgccttct catctcgctc ggcacgcacc aactcgcgct cgtcccggct       360
     tacgccgcgc ttcgccacgc gctctttctg ccctacttga ttcgatccgc cctcgccgcc       420
     gtcctgttcg aactcgcgcg cctcacagcc ctcgcgtgct ttcacggctc aatgcggcgg       480
     ctcggcgcgg catttggggc gcttcgcggc cttcacccag cggcactcct cattcccgcg       540
     tcgctcgcct cgcttctctc cgcgcacgaa gcggattggg ccgtcacgct tcccaccgcg       600
     gcgctgtttt tgagctttct ctggttatcc cgcgcccacg cgcggctcgc cgacgagtgt       660
     gagtcggctc gccagacgta ccgggtcatc gccgagaact cggccgatct cgtcctcatc       720
     gctgcgccga gcggcgagat caccttcgcg tctcccggct tcctcgcctc cgccgggctc       780
     agccgcgaat ccctcgtcgg ccgctccgtg ttcgatctcg tcgcgcccga agacttcgcc       840
     cgcttcgacg aactcttcac gccggctggc gcagacggcc aggagcacga tgtggcgctt       900
     gagattgacg acgtgcgcgt caacgtggcg ctgcgcctga cgctcatccg ctcgggcacc       960
     cattccccga gctacatcct ccaagcccgc gaccttgcgc cgcgcctccg gcgtgaagcc      1020
     agccgcctgc gcgatgagcg gctcgaagcc gtcggccagc tcgccgcgag catcgcgcac      1080
     gagtttcgca accctttgac gaccgtgatg ggttttgtgc aattgtttcg ctcgcagttc      1140
     gacgaactcg cgcccggcgc atacgaggcc atctggggcg agctcgagcg gatgaaggac      1200
     gtgaccgatt ccctcatggt cctcgccagg cccgaggcct tcaaacccat tccgtgcgat      1260
     ctcgccgaga tggcccgcgc cgccatcgga gcgtgcgaac cgctcgccct cgaacgaggc      1320
     gtcccggtcg atctcggccc gctgccgccg gcccaggtgc tcggccaccc aggccaattg      1380
     cggcaaatga tggttcacct cctgcgaaac gccatcgagg cggccgcgga aacccgagga      1440
     cgagtggttc tgtgggtcac gtcgacggag gccgaggcca tcgtgcacat ccaggacacg      1500
     gggccaggca ttccggactc agtactcgag cacctcggcg agccgctgta ccacacgaag      1560
     gaaaagggga cgggcctcgg gctgatggtg gtgcatcgca tcgtgcaaca gcacggcggc      1620
     cagatccaca ttcgccgcac cgaggcaccc atcggcaccg cggtagaagt gcgccttccg      1680
     atatcccgca ggtga                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page