(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE64

ALIAD_1.PE64         Location/Qualifiers
FT   CDS_pept        complement(83059..84255)
FT                   /locus_tag="Aaci_0065"
FT                   /gene_family="HOG000220178" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03469"
FT                   /codon_start="1"
FT                   /product="hopene-associated glycosyltransferase HpnB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: hopene-associated glycosyltransferase HpnB;
FT                   PFAM: glycosyl transferase family 2; KEGG:
FT                   bpd:BURPS668_A3051 glycosyl transferase, group 2 family
FT                   protein"
FT                   /db_xref="GI:258510084"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR017832"
FT                   /db_xref="GeneID:8423527"
FT                   /translation="MTALAWAAAVSLAAWIFLLFGRGFYWRTALSMNTARMAAEARAPR
FT                   AWPAVWAVVPARNEADVLPRTLPTLLSQAYPGEFHVVLVDDHSTDGTAEVAERLASELR
FT                   LAHRLRVVRADALPPGWAGKVWAMQNGLRHVPDDAAYVLFTDADISHSPTSVQALVARA
FT                   ERDGLDLVSLMVRLRAESAWEKLLIPAFVYFFAKLYPFAWVAHPRRRTAAAAGGCVLVR
FT                   RRLLPTPPGLEAIRDAVIDDCALARLVADGGGRLWLGLGDDVVSVRAYGTLGEIWRMIA
FT                   RTAFVQLRFSTVLLLGTALGMLLLYAVPPAAAIAGLVGLLAGAPGSLAALCLGGLAYAI
FT                   LASTFVPMLRWYRLSPARSALLPLAGVLYTLMTLDSARRFWLRTGDHWKGRPYEMRRP"
FT                   /protein_id="YP_003183518.1"
     atgacggcgc tggcttgggc cgcggccgta agcctcgcgg cgtggatctt cctgcttttc        60
     gggcgcggct tctattggcg cacggcgctc tccatgaaca ccgcaaggat ggcggccgag       120
     gccagggcgc cccgcgcgtg gccggccgtg tgggccgtgg tgcccgcgcg caacgaggcg       180
     gacgtcttgc cgaggacgct tccgacgctt ctctcgcagg cgtaccccgg tgagttccac       240
     gtcgtgctcg tggacgatca cagcacagac ggcacggcgg aggtggccga gcgccttgcg       300
     tcggagctta ggctcgcgca tcgtctgcgc gtggtgcgcg cggatgcgct tccgcctggg       360
     tgggcgggca aggtgtgggc catgcagaat ggtctcaggc acgtgccgga cgatgcggcg       420
     tacgtgctgt tcacggacgc ggacatctcg cattcaccga cgagcgtcca ggccctcgtg       480
     gcgcgggccg agcgagacgg gttggacctc gtctcgctca tggttcggct cagggccgag       540
     agcgcatggg aaaagctcct cattccagcg ttcgtctact tcttcgcgaa gctgtacccg       600
     ttcgcgtggg tcgctcaccc taggcgaagg accgcggccg cggcgggcgg atgcgtgctc       660
     gtcaggcgcc gcctgttgcc cacgcccccg gggcttgagg ccattcgcga cgccgtgatc       720
     gacgactgtg cgctcgctcg gctcgtggcg gatggcggcg ggcgcctctg gctcgggctt       780
     ggcgacgacg tggtgagcgt gcgggcgtac ggaaccctcg gcgaaatctg gcggatgatt       840
     gcgcgcaccg cgttcgtgca gctgcggttc tccaccgtgc tcctcttggg caccgccctc       900
     ggcatgctcc tcttgtacgc cgtgccaccc gctgccgcaa tcgccggcct cgtgggtctt       960
     ctggcgggcg cgccggggag cctcgccgct ttgtgccttg gcgggctcgc gtacgccatc      1020
     ctcgcctcga ccttcgtgcc gatgctccgg tggtaccgcc tgtctccggc gcgatccgcc      1080
     ctgcttccct tggccggcgt cctgtacacc ctcatgaccc tcgactccgc caggcggttc      1140
     tggctccgca cgggcgatca ctggaagggt cggccgtacg aaatgcgccg cccgtga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page