(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE66

ALIAD_1.PE66         Location/Qualifiers
FT   CDS_pept        85171..87126
FT                   /locus_tag="Aaci_0067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   afw:Anae109_0620 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="GI:258510086"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:8423529"
FT                   /translation="MQVNAHPRVRFSLRYKIIAILFGAMLVVLALGGTLFYSVARQQML
FT                   KSADKQAQLLAQQIELEVESSEAGQAYIDNLLGNELRIASIAIEKQLPPHWRDVTNEQL
FT                   RQLSAELGVSGITLLAPTADDIVGVRSSDPREIGLSTRGMGKWYIAFRDLLAGRPQAST
FT                   YGTAGKNYWSGPFANAASDPSKVDKWGYYYDGTTDYIIDPFYVQTSIPGYEQVVSVNST
FT                   IRHILATEPDILSIAVLNRTFDEKPIRYSYKGVSWIDIANQPVMYGAYRYADHDLDVRL
FT                   KDRALSTGHMQTALDHVDGTTVMKAFIPESEQGSRYIVEIVMNYRIITAQLGDLLHDMA
FT                   ILGGALLVLTGVLSFVGAELITRPLKRITEAVDEIADRNFAAHVDVARSDEIGVLAAHV
FT                   NEMSEKLVEYLRELTRRERGRGVDYLVMATQALVHELGTPLAAIRQMSELLPRLEPNLG
FT                   EKAREILERMRSASEYANRIARDFTAFLRNGMLTVRRRDVVRLVSDAVGLCSSMAQARH
FT                   VKLSFRNETGHRHVYLDVDEDKLFGAIVNLVRNAIDAIPDDRARREVDVTVRIEAEELH
FT                   IDVIDSGVGIPRDRWDRIFVPYSSTKKGGLGLGLTFCGLIAIAHGGTVGVVQSSPQGTH
FT                   IRMRLPLKHEPIQVDA"
FT                   /protein_id="YP_003183520.1"
     ATGCAGGTGA ACGCTCATCC CCGCGTGCGC TTCTCGTTGC GCTACAAGAT CATCGCCATC        60
     CTCTTCGGCG CCATGCTCGT GGTACTCGCG CTCGGCGGGA CGCTGTTTTA CAGCGTCGCC       120
     AGGCAGCAGA TGCTCAAGAG CGCGGACAAG CAGGCGCAAC TCCTCGCGCA ACAGATTGAG       180
     CTCGAGGTCG AGTCGAGCGA GGCCGGGCAA GCCTACATCG ACAATCTGCT CGGCAACGAG       240
     CTGCGGATTG CCTCCATCGC GATTGAAAAG CAGCTGCCGC CCCACTGGCG GGACGTGACG       300
     AACGAACAGT TGCGCCAGCT ATCCGCAGAG CTCGGCGTGA GCGGCATCAC GCTTCTCGCG       360
     CCCACCGCGG ACGACATCGT CGGCGTGCGC TCGTCGGATC CGCGCGAGAT TGGCCTTTCC       420
     ACGCGCGGCA TGGGCAAATG GTACATCGCC TTCCGCGATC TGCTCGCCGG AAGGCCCCAG       480
     GCGTCCACGT ACGGCACTGC GGGGAAAAAC TACTGGTCTG GGCCGTTCGC CAACGCCGCC       540
     TCCGATCCGT CCAAGGTCGA CAAGTGGGGC TACTACTACG ACGGCACGAC GGATTACATC       600
     ATCGATCCGT TTTACGTCCA GACGTCCATT CCCGGCTACG AACAGGTGGT CAGCGTCAAC       660
     AGCACCATTC GCCACATCCT GGCGACGGAG CCCGACATCC TGTCCATCGC CGTGCTGAAC       720
     AGGACGTTCG ACGAGAAGCC CATCCGCTAC TCGTACAAAG GCGTCTCCTG GATCGATATC       780
     GCCAATCAGC CTGTCATGTA CGGCGCCTAT CGCTATGCCG ATCACGACCT CGACGTCCGG       840
     CTCAAAGACC GCGCTTTGTC CACGGGCCAC ATGCAGACGG CTCTCGATCA CGTCGACGGC       900
     ACGACCGTGA TGAAAGCGTT CATCCCCGAG TCGGAGCAGG GGAGCCGATA CATCGTCGAG       960
     ATCGTGATGA ACTATCGCAT CATCACCGCT CAGCTCGGCG ATCTTCTGCA CGACATGGCC      1020
     ATTCTGGGCG GCGCGCTCCT CGTGCTGACC GGCGTGCTGT CGTTCGTAGG CGCCGAACTC      1080
     ATCACGCGCC CGCTCAAGCG CATCACCGAG GCCGTGGACG AGATTGCCGA CCGGAATTTC      1140
     GCGGCGCACG TCGACGTGGC GCGGTCGGAC GAAATTGGCG TGCTCGCCGC GCACGTGAAC      1200
     GAGATGTCGG AGAAGCTGGT GGAATATTTG CGCGAGCTGA CCCGGCGCGA GCGCGGGAGA      1260
     GGCGTGGACT ACCTCGTGAT GGCCACGCAG GCGCTGGTGC ACGAGCTCGG CACGCCGCTC      1320
     GCCGCCATTC GGCAGATGTC GGAGCTGTTG CCGAGGCTCG AGCCGAACCT CGGAGAGAAG      1380
     GCGCGCGAGA TCCTCGAGCG GATGCGATCC GCCTCCGAAT ACGCCAACCG AATTGCGCGC      1440
     GACTTCACGG CGTTCTTGCG CAACGGCATG TTGACCGTGA GGCGCCGGGA CGTGGTGCGC      1500
     CTGGTGTCGG ACGCCGTTGG CCTATGTTCG TCCATGGCCC AGGCCCGCCA TGTGAAACTC      1560
     TCGTTCCGGA ACGAGACCGG ACATCGGCAC GTGTACCTCG ATGTGGATGA AGACAAGCTG      1620
     TTCGGCGCCA TCGTGAACCT CGTGAGAAAC GCCATTGACG CCATTCCGGA CGATCGCGCC      1680
     CGCCGCGAGG TCGACGTGAC GGTGAGAATT GAGGCCGAAG AGCTGCACAT CGACGTGATT      1740
     GACAGTGGCG TCGGGATCCC GCGGGACCGC TGGGACCGGA TCTTTGTCCC GTACAGTTCC      1800
     ACGAAAAAGG GCGGGCTCGG CCTCGGGCTC ACGTTCTGCG GCCTCATCGC CATCGCGCAC      1860
     GGCGGGACGG TGGGCGTGGT CCAGTCCAGC CCTCAGGGCA CGCATATCCG CATGCGCCTG      1920
     CCCCTCAAGC ACGAGCCGAT TCAGGTGGAC GCGTAG                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page