(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE67

ALIAD_1.PE67         Location/Qualifiers
FT   CDS_pept        complement(87111..88232)
FT                   /locus_tag="Aaci_0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /codon_start="1"
FT                   /product="transglutaminase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain protein; Protein of
FT                   unknown function DUF553; SMART: transglutaminase domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="GI:258510087"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR007562"
FT                   /db_xref="GeneID:8423530"
FT                   /translation="MNDWLEWVLWAIVAVSALAGFRRGFERESRRLVQTAAFVAEVVAS
FT                   SAAAFAASRSIRNFVLQDSQSASVPSWLAHLAAFWQQSPRLCNWIAFLAAYLVVSSAIG
FT                   ALLAPLGARWIRPRGRMRALSRAGGLVVGGVLGAFRAAAVGACLFLVLQYVSAPALARA
FT                   SQASPAYRWLSHHVYTPWLRPIAEREMPVLAKGAAQTVAADISLFVVPTGPGEETGILV
FT                   VPKPVAEKALAITSGLTSPYAKARALYEWEIDHVHYDWKKYDDYVDDGKWDAQSPLTTL
FT                   ETGKGVCADYALLYADMAHAVGLTVRIDEGVAVTGGVEGSHAWNEVWIPDQHRYILVDP
FT                   TWGSAQDAWFDVPPAVFDETHRLTTRITIYAST"
FT                   /protein_id="YP_003183521.1"
     gtgaacgact ggctggagtg ggtgttgtgg gcgattgtgg cggtttcggc cttggcgggc        60
     tttcggcgcg gatttgagcg agagtcgcgg aggcttgtgc agaccgcggc gtttgtcgcc       120
     gaggtcgtcg cttcgtccgc ggccgccttt gcggcaagcc gctctatccg caacttcgtc       180
     ctgcaggata gccagagtgc gtccgtgccc agttggctag cgcatctcgc cgctttttgg       240
     cagcagtccc cgaggctgtg caactggatt gcgtttctcg ccgcctacct cgtcgtctcg       300
     tccgccatcg gggcgctgct cgcgccgctc ggcgcccggt ggatccgccc gcgcggacgc       360
     atgcgcgccc tgagccgcgc cggcgggctc gtggtcggcg gcgtgcttgg cgcctttcgc       420
     gccgcggcgg tcggcgcctg cctgtttctc gttctccagt atgtgtctgc gccagctctc       480
     gcgcgcgcct cccaggcgtc gcccgcgtac cgctggctgt cgcatcacgt ctacacgccg       540
     tggcttcgcc ccatcgcgga gcgcgaaatg ccggttttgg ccaaaggtgc ggcgcagacc       600
     gtggcagcgg acatctccct gtttgtcgtg cccaccggcc ccggcgagga gacgggcatt       660
     ctcgtcgtgc caaaacctgt ggcggaaaag gccctggcca tcacaagcgg attgacctct       720
     ccgtacgcca aggcgcgcgc cctgtacgag tgggagattg accacgtcca ctacgactgg       780
     aagaaatacg acgactacgt cgacgatggc aaatgggacg ctcagtcccc gctcaccacg       840
     ctggagaccg ggaagggcgt gtgcgccgac tacgcgctcc tctatgcgga tatggcgcac       900
     gccgtgggcc tgaccgtgcg catcgacgag ggcgtggcgg tgaccggcgg cgtggaaggg       960
     tcccacgcat ggaacgaggt gtggatcccg gaccagcacc ggtacatcct ggtggacccc      1020
     acctggggct ccgctcagga cgcgtggttt gacgtgccgc cggccgtctt cgacgagacg      1080
     cacaggctca cgacccgcat caccatctac gcgtccacct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page