(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE69

ALIAD_1.PE69         Location/Qualifiers
FT   CDS_pept        89298..89894
FT                   /locus_tag="Aaci_0070"
FT                   /gene_family="HOG000076391" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.1.21"
FT                   /codon_start="1"
FT                   /EC_number="2.7.1.21"
FT                   /transl_table="11"
FT                   /note="PFAM: thymidine kinase; KEGG: sei:SPC_1979 thymidine
FT                   kinase"
FT                   /db_xref="GI:258510089"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="GeneID:8423532"
FT                   /translation="MAKLYFRFGQMNASKSIQLLTVAHSYEEQGKKVALFTPAIDDRYG
FT                   RGVIASRVGIAKRAVVVEEDTDLFACVRAQMPDCVLVDEVQFLRAYHVRQLARVADDLD
FT                   IPVIMYGLLKDYRNRLFEGSEAAILWADRIEEIKTICAHPGCDRKATMILKVKDGRPVY
FT                   EGEQIEVGGNDLYKSVCRKHYFHPDVEGLMRATGP"
FT                   /product="Thymidine kinase"
FT                   /protein_id="YP_003183523.1"
     GTGGCCAAGC TGTACTTTCG CTTTGGACAG ATGAACGCCA GCAAGTCCAT CCAACTGTTG        60
     ACCGTCGCGC ACAGCTACGA GGAACAGGGC AAGAAGGTGG CGCTGTTCAC GCCTGCCATC       120
     GACGACCGGT ACGGGCGCGG CGTCATCGCG TCCAGGGTGG GCATCGCCAA GCGGGCCGTC       180
     GTCGTGGAGG AGGACACCGA CCTGTTCGCG TGCGTGCGCG CGCAGATGCC CGACTGCGTG       240
     CTGGTGGACG AGGTCCAGTT CCTCCGCGCC TATCACGTGC GGCAGTTGGC GCGCGTGGCG       300
     GACGATCTCG ACATCCCGGT GATCATGTAC GGCCTCCTGA AGGACTACCG CAACCGCCTG       360
     TTCGAGGGCA GCGAGGCGGC CATCCTGTGG GCGGACCGGA TAGAAGAGAT CAAGACCATC       420
     TGCGCGCATC CCGGCTGCGA CCGCAAGGCG ACGATGATCC TCAAGGTGAA AGACGGGCGC       480
     CCGGTGTACG AGGGCGAGCA GATTGAAGTC GGCGGCAACG ATCTCTACAA ATCCGTCTGC       540
     CGCAAGCACT ACTTTCACCC GGACGTGGAG GGCCTGATGC GCGCCACAGG CCCATGA          597
//

If you have problems or comments...

PBIL Back to PBIL home page