(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE70

ALIAD_1.PE70         Location/Qualifiers
FT   CDS_pept        complement(89934..90287)
FT                   /locus_tag="Aaci_0071"
FT                   /gene_family="HOG000221987" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_1600 hypothetical protein"
FT                   /db_xref="GI:258510090"
FT                   /db_xref="GeneID:8423533"
FT                   /translation="MKCIYLSGPMTGLPHGNRPAFLEAAQSLRARGFRVINPAEYGSPE
FT                   DDWYAAMRRDIRMLMDADAVVTLPGWERSRGARLEVYVACQLNMPVYTLTACLRAAEED
FT                   LAKAPAIQLSLEL"
FT                   /protein_id="YP_003183524.1"
     gtgaagtgca tctatctgtc cggtcccatg acggggctcc cgcacgggaa tcgcccggcc        60
     ttcctggagg ccgctcagtc actccgcgcg cggggctttc gggtcatcaa cccggccgaa       120
     tatggttcgc ccgaagacga ttggtacgcc gccatgcgcc gagacatccg catgctgatg       180
     gacgcggacg ccgtggtgac gctccctggg tgggagcgct cgcgcggcgc ccgactggaa       240
     gtgtacgtgg catgtcagtt gaacatgcct gtgtacacgc ttactgcctg tcttcgcgca       300
     gcggaagagg acctggcgaa ggcgcccgcc atccagctgt cgctcgagct gtga             354
//

If you have problems or comments...

PBIL Back to PBIL home page