(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE73

ALIAD_1.PE73         Location/Qualifiers
FT   CDS_pept        complement(93316..94089)
FT                   /locus_tag="Aaci_0074"
FT                   /gene_family="HOG000004695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /codon_start="1"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: rle:pRL120015 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="GI:258510093"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="GeneID:8423536"
FT                   /translation="MIRELLMRDDTLFIAHRGASAECPENTLPAFVRAAELGADMIELD
FT                   VRLTGDGGVVVLHDPTVDRTTNGSGLAADMRLADLRKLDAGSWFDARFRGTLIPTLDEV
FT                   FATVPHMCLNIELKTSPVAHTRQLIRRVLGAIYRHNARDRVLISSFDHAALAEVRRFDR
FT                   DIAIGVLFTGRLLEPIQLAERLGAQSLHPDIEHLDPLFVAEAKSHHLAVYAWTAKSELA
FT                   VNRALACQVSGIILDDLRLRQIATKAVPSPTPPSA"
FT                   /protein_id="YP_003183527.1"
     atgattcgag aactcctgat gcgcgacgac acgctcttta tcgcccaccg cggcgcgtcc        60
     gccgaatgcc cggagaacac gctgcccgcc ttcgtgcggg cggcggaatt gggcgcggac       120
     atgattgagc tcgacgtccg cctgacgggc gacggcggcg tcgtggtcct gcacgatccg       180
     acggtcgacc ggacgaccaa cggcagcggc ctggccgccg acatgcgcct cgccgatctg       240
     cgcaagctcg acgccggatc gtggtttgac gcgcgctttc gcggcacact catccccacg       300
     ctcgacgagg tgttcgcgac cgtgccgcac atgtgcctga acatcgagct gaagacgagc       360
     cccgtcgcgc acacccgcca gctcatccgc cgcgtccttg gcgccattta ccgccacaac       420
     gcgcgcgatc gcgtcctcat ctcctccttc gatcacgccg cgctggccga ggttcgccgc       480
     ttcgaccgcg acatcgccat cggcgtgctc ttcaccgggc gcctgctcga gcccatccag       540
     ctcgcggagc gcctcggcgc gcagagcctc caccccgaca tcgaacatct ggatcccctg       600
     tttgtggccg aggccaaatc ccaccacctc gcggtgtacg cgtggaccgc gaagagcgag       660
     ctggccgtga accgggcctt ggcgtgccag gtgtccggca tcatcctgga cgatctccgg       720
     ctgaggcaaa tcgccaccaa ggctgtcccc tcgcccacgc cgccctccgc gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page