(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE74

ALIAD_1.PE74         Location/Qualifiers
FT   CDS_pept        complement(94121..95446)
FT                   /locus_tag="Aaci_0075"
FT                   /gene_family="HOG000227636" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: kpu:KP1_0565 putative sn-glycerol-3-phosphate-
FT                   binding periplasmic protein"
FT                   /db_xref="GI:258510094"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="GeneID:8423537"
FT                   /translation="MKRDRLWKSGALLALGLVATGCGAPAANGGGQAATGASRAAASSQ
FT                   PVTITFWYGVGTTLSQDIQQMVQAFNQTHPGIKVVATYQGSYSGGGEEQQKLLAAIKAG
FT                   DPPTIAQIEVHAMPVFAASGQLLDLTNLMQSSSVDKPSNFLPGILVSTQYQGRYYAVPF
FT                   NRSVPVLYYNKTLFAKAHIASPPSNWAQLAADAKKLTSGAGSNKIYGFEPLVDWWPWEY
FT                   AVESGGGSILSPDLKRATFDQPPALSILETEQSLVKQGYAKVETGPNYWDLMTQDFING
FT                   QVAMDIDSIGSAGKVTKGVGDKFQWGTALLPRGKTLAVPPGGGDLAIFKDATPAQQKAA
FT                   WTFIQWWTAPKQSVQWSTETGYLPVQKADLNDPVYQAYLEKHPQYRTAIEELQYEHPSP
FT                   ASPAYLAVLQPVQQALQGIFDEGKPVAATMHQAAEAADQNLG"
FT                   /protein_id="YP_003183528.1"
     atgaagcgag atcgactgtg gaaatccggc gcgctcctgg cgctcggact tgtggcgacg        60
     ggatgcggtg cgcccgccgc aaacggcggc ggacaggcgg cgaccggcgc cagccgggcc       120
     gcggcatcga gccagcccgt gaccatcacc ttctggtacg gcgtcggcac gacgctcagc       180
     caggacattc agcagatggt gcaggcgttc aaccagaccc accccggcat caaggtcgtg       240
     gcgacctatc aaggcagcta ctccggcggc ggcgaggaac agcagaagct gctcgcggcc       300
     atcaaggcgg gcgatccgcc caccatcgca caaattgagg tgcacgcgat gccggttttc       360
     gcggcgagcg ggcaattgct cgacctcacc aacctgatgc agtcttcgag cgtcgacaag       420
     ccgtccaact tcctgccggg catcctcgtc tcgacccagt accagggccg atactacgcg       480
     gtgcccttca accgcagcgt gcccgtgctc tactacaaca agacgctctt cgcgaaggcg       540
     cacatcgcct cgcccccctc gaactgggcg cagctcgcgg cggacgcgaa gaagctcacg       600
     agcggggccg gatcgaacaa gatctacggt ttcgaaccgc tcgtcgactg gtggccgtgg       660
     gaatacgcgg tggagtcagg cggcggctcc atcctgtcgc ccgatttgaa gcgcgccacc       720
     ttcgaccagc cgcccgcgct ctccatcctc gagacggagc agtcgctcgt gaagcaggga       780
     tacgccaagg tcgagacggg accgaactac tgggacctca tgacgcagga cttcatcaac       840
     ggccaagtgg ccatggacat cgactccatc ggcagcgcgg gcaaggtgac gaagggcgtg       900
     ggcgacaagt tccagtgggg caccgcgctc ctgccgcgcg gcaagacgct cgccgtcccg       960
     ccgggcggtg gcgatctcgc catcttcaag gacgccacgc ccgcgcaaca gaaggccgcg      1020
     tggacgttca tccagtggtg gaccgcgccc aagcagtcgg tccaatggtc caccgagacc      1080
     ggttacctgc ccgtgcagaa ggcggatctg aacgaccccg tctaccaggc gtacctcgag      1140
     aagcacccgc agtaccggac cgccattgag gagctccagt acgagcatcc gtcgccggcg      1200
     tcccccgcgt acctggccgt gctgcagccg gtgcaacagg cgctgcaagg catcttcgac      1260
     gagggcaagc ccgtcgcggc cacgatgcat caggccgcag aggccgccga tcaaaacctc      1320
     ggatga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page