(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE77

ALIAD_1.PE77         Location/Qualifiers
FT   CDS_pept        97441..98682
FT                   /locus_tag="Aaci_0078"
FT                   /gene_family="HOG000023469" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /codon_start="1"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   bhe:BH02500 aminopeptidase"
FT                   /db_xref="GI:258510097"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="GeneID:8423540"
FT                   /translation="MIEQMRKYAELVVRVGVNLQPGQPLVIGFGSRQVYPDQVPFARLL
FT                   AQAAYDAGASYVHIDWGDEWWLRETVKRADLAILRQCAQWQVEWVERLAEMGAAYVAMP
FT                   ASDPALFAGIPRDRVEQAERAVREAFRLFDNQRTSDRYRWTLASAPTQAWADAVHPELP
FT                   REDRLEALWRDILQASRATGEDPIADWEQHIANLKRRAAWLNDLKIHALHYRAPGTDLT
FT                   IELAEGHYFEAAGHPDVKGFRFVANIPTEEVFTAPKKTGVNGTVASTMPLNHGGSLIEG
FT                   IRLRFENGRIVEYSAEKGEEALKAIIEADEGSHYLGEVALVPVDSPIAQMNRIFYNTLF
FT                   DENASCHLAIGRAYPLIEGGHELAHEDWEAHGLNDSLMHVDFMIGSADLDIDAVLQDGR
FT                   TVPIFRKGRWASEA"
FT                   /protein_id="YP_003183531.1"
     GTGATCGAAC AAATGCGAAA ATACGCTGAA CTCGTCGTGC GAGTGGGGGT GAATCTGCAA        60
     CCAGGGCAGC CGCTCGTCAT TGGCTTCGGA TCGCGCCAGG TGTATCCGGA TCAGGTGCCG       120
     TTTGCAAGGC TTCTCGCGCA GGCCGCCTAC GACGCGGGCG CGAGCTACGT GCACATCGAC       180
     TGGGGCGACG AGTGGTGGCT GCGCGAGACG GTCAAGCGCG CGGATCTCGC CATCCTGCGC       240
     CAGTGCGCCC AGTGGCAAGT CGAATGGGTG GAGCGCCTCG CGGAGATGGG CGCCGCTTAC       300
     GTCGCCATGC CGGCGAGCGA TCCGGCGCTG TTTGCCGGTA TCCCGCGCGA TCGCGTCGAG       360
     CAGGCGGAGC GGGCGGTGCG AGAGGCGTTT CGGCTGTTCG ACAACCAGCG CACGAGCGAT       420
     CGCTACCGCT GGACGCTGGC CTCGGCGCCG ACGCAGGCCT GGGCCGACGC GGTGCACCCG       480
     GAGCTGCCGC GCGAGGATCG GCTTGAAGCC CTCTGGCGGG ATATCCTGCA GGCGTCGCGG       540
     GCGACGGGCG AAGATCCCAT CGCAGACTGG GAGCAGCACA TCGCGAACCT GAAGCGCCGC       600
     GCGGCATGGC TGAACGACCT CAAGATTCAC GCTCTGCACT ACCGGGCGCC GGGTACGGAT       660
     CTCACCATTG AGCTCGCGGA GGGCCACTAC TTTGAGGCGG CCGGCCATCC CGACGTCAAG       720
     GGATTTCGCT TCGTCGCCAA CATCCCGACG GAAGAGGTGT TCACGGCGCC GAAGAAGACC       780
     GGCGTGAACG GCACGGTCGC GAGCACGATG CCGCTCAATC ACGGCGGATC GCTCATCGAA       840
     GGCATTCGCC TGCGCTTCGA AAACGGGCGC ATTGTCGAGT ACAGCGCGGA GAAGGGCGAG       900
     GAAGCGCTCA AGGCTATCAT CGAGGCGGAC GAGGGCAGCC ATTACCTCGG CGAGGTGGCG       960
     CTCGTGCCGG TGGACTCGCC CATCGCGCAG ATGAATCGCA TCTTCTACAA CACGTTGTTC      1020
     GACGAAAACG CCAGCTGCCA CCTGGCCATC GGTCGCGCGT ATCCCCTCAT CGAGGGCGGC      1080
     CACGAGCTCG CGCATGAGGA CTGGGAGGCG CACGGCCTGA ACGACAGCCT CATGCACGTG      1140
     GACTTCATGA TTGGCTCGGC CGATCTCGAC ATCGACGCGG TGCTTCAGGA CGGCCGCACG      1200
     GTGCCCATCT TCCGCAAAGG GCGCTGGGCG AGCGAGGCGT AA                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page