(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE79

ALIAD_1.PE79         Location/Qualifiers
FT   CDS_pept        complement(100377..101015)
FT                   /locus_tag="Aaci_0080"
FT                   /gene_family="HOG000242641" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00504"
FT                   /codon_start="1"
FT                   /EC_number="3.4.19.3"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_4364 pyrrolidone-carboxylate
FT                   peptidase; TIGRFAM: pyrrolidone-carboxylate peptidase;
FT                   PFAM: peptidase C15 pyroglutamyl peptidase I"
FT                   /db_xref="GI:258510099"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="GeneID:8423542"
FT                   /translation="MDAILVTGFEPFQGEALNPSWEVARSLAGETVGVHYRVIARRLPT
FT                   VYGRAGEELVSAIREVKPRAVVCLGEAGGRTHVTPERIAINIMDARIPDNAGQKPIDEP
FT                   IAPDGPAAYFSTLPIRAMVEAMCGAGIPAHISNTAGTFVCNDTFYRLMHFIAEESPGII
FT                   GGFIHVPYMTEQALHKQAPSLPLTTLVAGVRTALAVVASALGPAGVPKC"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /protein_id="YP_003183533.1"
     atggacgcga tattggtgac aggattcgag ccgtttcagg gcgaggcgct caacccgtcg        60
     tgggaggtgg cgagatcgct cgcgggcgag accgtgggcg tccactatcg ggtgattgcg       120
     cggcgcctgc ccacggtgta cggccgggcc ggagaggaac ttgtgagtgc catccgagag       180
     gtcaagccgc gcgccgtcgt ctgcctgggt gaagccggtg gccgcacgca cgtgaccccg       240
     gagcgcatcg ccatcaatat catggacgcg cgcattccgg acaatgcggg ccaaaagccc       300
     atcgacgaac ccatcgcgcc ggacgggccc gccgcctact tttcgacgct tccgattcgc       360
     gccatggtgg aggccatgtg tggcgccggc attcccgcgc acatctcgaa cacggcgggg       420
     acgttcgtgt gcaacgacac gttctaccgc ctgatgcact tcatcgccga ggagtcccca       480
     ggtatcatcg ggggcttcat ccacgtgccc tacatgaccg agcaggcgct tcacaagcag       540
     gcgccgtccc tgccgctcac gacgctcgtt gcaggcgtcc gcacggcgct cgcggtggtg       600
     gcttcggcgc tcgggccggc gggcgtgccg aagtgctag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page