(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE80

ALIAD_1.PE80         Location/Qualifiers
FT   CDS_pept        101198..101806
FT                   /locus_tag="Aaci_0081"
FT                   /gene_family="HOG000085119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dal:Dalk_1395
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:258510100"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:8423543"
FT                   /translation="MRDRIEEAAKRAFSEFGYKGTTMDQIARLAGVSKGAIYLHFPSKE
FT                   ALFQHMLRGVIAQVRDAFESAQVEGDDYFRNLERGLRALMRFRADHAMLSKLVQEVRQF
FT                   GTAEARAGLGELEAAILDYLARHLKRGVELGVVRPCRANLVAFVLLRAYTAVLRDFPSA
FT                   EGPLSEEDLYQLFTGVFVDGLRLRPGEGEPRNTQSEQER"
FT                   /protein_id="YP_003183534.1"
     GTGCGGGATC GCATTGAGGA GGCCGCCAAG CGGGCGTTCT CCGAGTTTGG CTACAAAGGC        60
     ACGACCATGG ACCAGATTGC CCGGCTCGCG GGCGTCAGCA AGGGGGCCAT TTATCTTCAC       120
     TTCCCGAGCA AGGAAGCGCT GTTTCAACAC ATGCTGCGCG GGGTCATCGC GCAGGTGCGA       180
     GACGCGTTCG AGTCGGCCCA GGTGGAGGGC GACGATTACT TTCGCAATCT CGAGCGCGGC       240
     CTGCGCGCGC TCATGCGGTT TCGCGCCGAT CACGCCATGC TCTCGAAGCT CGTCCAGGAG       300
     GTCCGGCAAT TTGGGACGGC GGAGGCGCGC GCGGGGCTCG GGGAGCTTGA GGCCGCCATC       360
     CTGGACTACC TGGCGCGCCA CCTGAAGCGC GGCGTGGAGC TCGGCGTGGT GCGCCCGTGC       420
     CGGGCCAATC TCGTCGCGTT TGTCCTCCTT CGCGCCTACA CCGCGGTTTT GCGCGACTTT       480
     CCGTCTGCGG AAGGTCCGTT GTCCGAAGAG GACCTGTACC AGCTTTTCAC CGGCGTGTTT       540
     GTCGACGGCT TGCGCCTGAG GCCCGGCGAG GGCGAGCCCA GGAACACGCA GAGTGAGCAG       600
     GAGAGGTGA                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page