(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE81

ALIAD_1.PE81         Location/Qualifiers
FT   CDS_pept        101812..104169
FT                   /locus_tag="Aaci_0082"
FT                   /gene_family="HOG000065090" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /codon_start="1"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: YhgE/Pip C-terminal domain protein;
FT                   YhgE/Pip N-terminal domain protein; KEGG: SRP ; K01421
FT                   putative membrane protein"
FT                   /db_xref="GI:258510101"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="GeneID:8423544"
FT                   /translation="MASVPEGTARGNVFQEFARLRRPKMMVQAAGIALIPVLYAGAFLW
FT                   AFWNPYGHLDRLPVAVVNEDAGASFRGERLNAGRDLVEKLRSDHSLGWHFVTPAQASAG
FT                   MADGAYAMEIVIPRDFSKRAVNRAEHTGAPAPEITSVTNDRYNYIAGVIGRNAAVKLAS
FT                   ETALELAKSYTASLVDALESSGTGLHKAAKAADALASGGRELEAKGELLVSGASQLAAG
FT                   ADRLAGGLEQASQGAGALAQGASQAVSGADRLNAGLVRLNQGAESLAQGASSWANQARA
FT                   FGEAGDKLGEAAQEVGQGASQLAAGAGKLTTSLGQLDTGASHLASGAEALAQNASQFAQ
FT                   AANQTAAGSQQVASGAKQLAEGLQQLAKANPALAETPAFQSLLATSAEVAQGAAQTASA
FT                   NEQLASGAAGLSQGASQLAAGAESLASGLKQAEAGAAPLQQGLQQLAQGASGVAQGGTR
FT                   LAAASGQLATGASQIAQGAKGLAAGTGAAQQASSSLRGGLVQLQGGAAKLAVGNRALAG
FT                   GAASLASGAGKLANGLGAYQAGVGKLASGSEALAANLANGASKLQALHGGAVIAAVAHP
FT                   VSLHQVELGDIQTYGNGFAPYFLSLGLYVGVLMMSVIFPFREPYGEPKSGVAWFFSKWL
FT                   LVVAIAWAQALIADAVVLGLVGVHTAHPLGFVLFSLFASTTFASILLALVALLDNPGRF
FT                   LGVVLLILQLTSTSGTYPVSLSPRFFQAVGPWLPMYATVSGFRYLIGGGDPSLMARDLA
FT                   ELAIYTASFIAIGVLLFAGFFRRLGRAEPKTV"
FT                   /protein_id="YP_003183535.1"
     ATGGCAAGCG TTCCCGAAGG CACTGCGCGC GGAAATGTCT TTCAGGAGTT CGCGAGGCTG        60
     CGCAGACCCA AGATGATGGT GCAAGCCGCC GGGATCGCGC TCATCCCGGT GTTGTACGCG       120
     GGCGCGTTTC TCTGGGCGTT TTGGAATCCC TACGGCCATC TCGATCGCCT GCCGGTGGCC       180
     GTGGTCAATG AGGATGCGGG CGCCTCGTTT CGCGGCGAGC GGTTGAACGC GGGACGAGAC       240
     CTCGTCGAGA AGCTGAGGAG CGATCACAGC CTCGGCTGGC ACTTCGTGAC ACCCGCGCAG       300
     GCCTCCGCGG GGATGGCGGA CGGGGCGTAT GCGATGGAAA TCGTCATCCC GCGCGACTTT       360
     TCGAAGCGCG CGGTGAATCG CGCCGAGCAT ACAGGCGCGC CTGCGCCGGA GATCACGAGC       420
     GTCACGAATG ATCGGTACAA CTACATCGCG GGCGTGATCG GGCGGAACGC GGCGGTGAAG       480
     CTTGCGTCGG AGACGGCGCT GGAGCTTGCG AAGTCCTACA CGGCGTCGCT CGTCGATGCG       540
     CTAGAAAGCT CGGGCACGGG GCTTCACAAG GCGGCGAAGG CCGCGGATGC GCTCGCCTCC       600
     GGCGGGCGAG AGCTTGAGGC GAAAGGCGAG TTGCTGGTGA GCGGAGCGTC CCAGTTGGCT       660
     GCGGGCGCGG ATCGGCTGGC GGGTGGACTC GAGCAGGCGT CTCAGGGCGC GGGCGCGCTG       720
     GCGCAAGGTG CGTCGCAGGC TGTGTCCGGC GCGGACCGCT TGAACGCGGG GCTTGTACGG       780
     CTGAACCAAG GCGCTGAGTC GCTCGCGCAG GGCGCTTCAT CCTGGGCGAA CCAAGCGCGC       840
     GCGTTCGGGG AGGCGGGGGA CAAGCTGGGC GAGGCGGCTC AAGAGGTCGG ACAGGGCGCG       900
     TCCCAGCTGG CCGCGGGCGC GGGCAAGCTC ACGACAAGTC TGGGTCAGTT GGATACCGGC       960
     GCGTCGCATC TCGCGTCTGG CGCCGAGGCG CTCGCGCAAA ACGCGTCCCA GTTCGCGCAG      1020
     GCCGCGAATC AGACCGCGGC GGGATCGCAG CAAGTGGCGT CCGGCGCGAA ACAGTTGGCG      1080
     GAAGGGCTTC AGCAGTTGGC GAAGGCCAAT CCTGCGCTCG CCGAGACGCC TGCGTTTCAA      1140
     TCGCTCCTCG CGACGAGCGC AGAGGTGGCG CAGGGCGCCG CGCAGACCGC GTCGGCCAAT      1200
     GAACAGCTGG CCTCTGGCGC GGCAGGACTT TCGCAGGGGG CGTCGCAGTT GGCTGCGGGC      1260
     GCCGAGTCGC TTGCGTCCGG GCTGAAGCAG GCGGAAGCCG GCGCGGCCCC GCTGCAACAG      1320
     GGGCTTCAAC AGTTGGCGCA GGGGGCAAGC GGCGTGGCGC AAGGAGGCAC GCGGTTGGCG      1380
     GCGGCATCCG GCCAACTCGC CACCGGCGCC AGCCAAATCG CGCAAGGGGC TAAGGGACTT      1440
     GCGGCGGGCA CCGGCGCGGC GCAGCAGGCT TCGTCCTCTC TGCGCGGCGG CTTGGTGCAG      1500
     CTTCAGGGAG GCGCCGCCAA GCTCGCCGTG GGCAACCGCG CGCTCGCGGG CGGCGCGGCG      1560
     TCGCTCGCAA GCGGCGCGGG AAAGCTTGCA AACGGCCTCG GCGCCTACCA GGCGGGCGTG      1620
     GGCAAGCTCG CGAGCGGTTC AGAGGCCCTC GCGGCGAACC TCGCGAACGG AGCGTCCAAG      1680
     CTGCAGGCGC TCCACGGCGG CGCCGTGATC GCCGCCGTGG CGCACCCAGT CTCCCTGCAT      1740
     CAGGTGGAGC TCGGCGACAT TCAGACCTAC GGCAACGGGT TTGCGCCCTA CTTCCTGTCG      1800
     CTCGGGCTGT ACGTCGGCGT GCTGATGATG AGCGTCATCT TCCCGTTCCG CGAGCCTTAC      1860
     GGCGAGCCGA AAAGCGGCGT CGCGTGGTTC TTCTCGAAGT GGCTGCTCGT CGTCGCCATC      1920
     GCGTGGGCGC AGGCGCTCAT CGCCGACGCC GTCGTGCTCG GCCTCGTCGG GGTGCACACG      1980
     GCGCATCCGC TCGGATTCGT GCTCTTTTCG CTTTTCGCAA GCACGACCTT CGCGTCCATC      2040
     CTGCTCGCGC TGGTGGCGCT GCTTGACAAC CCCGGCCGCT TCCTCGGCGT GGTGCTCCTC      2100
     ATTCTGCAGC TCACGTCGAC GTCGGGGACC TACCCGGTGA GCCTGTCGCC TCGCTTCTTT      2160
     CAGGCGGTGG GGCCGTGGCT GCCCATGTAC GCCACCGTGA GCGGATTCCG CTATCTCATC      2220
     GGCGGCGGCG ATCCGTCCCT GATGGCGCGC GATCTCGCGG AGCTCGCCAT CTACACCGCG      2280
     TCGTTCATCG CCATCGGCGT GCTGCTTTTC GCAGGTTTCT TCCGGCGCCT TGGGCGCGCG      2340
     GAGCCCAAAA CGGTGTAA                                                    2358
//

If you have problems or comments...

PBIL Back to PBIL home page