(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE82

ALIAD_1.PE82         Location/Qualifiers
FT   CDS_pept        104303..106660
FT                   /locus_tag="Aaci_0083"
FT                   /gene_family="HOG000040246" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mlg_1110"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aeh:Mlg_1110 hypothetical protein"
FT                   /db_xref="GI:258510102"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="GeneID:8423545"
FT                   /translation="MEGQPSARHPDWESEQAYVDRVVAAMRAKLAELEGVLRGVRGEIV
FT                   EFRRHFWDDVTINLSTLDDLVETHFAIRQQAEVLGERERRYQQAAKTKRTLERQISSPF
FT                   FARIDFRYEGEREAEPIYIGIASFRDERDQTFLVHDWRAPISSVYYDALPGPASFKAPA
FT                   GIVRGELTLKRQFVIRGGAILAMFDAGLTIGDELLMYALSRRSDAQMHNIVATIQRQQN
FT                   VVIRDDESPALLVTGAAGSGKTSAALQRAAYLLYKHRGDLDARQMLFFSPNPLFMSYIS
FT                   NVLPELGEDNIEQATFYDYLCARLQDEFVVEDPFDQMERLLEAGEDSRMARAVRYKASK
FT                   AFADEIDRYVAGLAPQMRFHPILVEGRVIATATDVKAAFDRTDPGLRLPLRVDLVKEEL
FT                   LNRLRQFERDEALSDWVQKAVDGLPDEAYRRAERTAAKRKRERPDLDEQEEARRLLGRE
FT                   VLRRMLRPVRRFVETLRFVDTAGMYRAWFEQAASSPPEGFQSEDWAQICRQTVREMDEG
FT                   TLWYEDATPYLYMKEQILGRAVSAPIRHVLVDEVQDYSVLQLRLIRSLFPYSRITMLGD
FT                   PEQLVSPHRPGILEEDEMARLFPGLVRVAFGQSYRSTRQIVLFTRGMVPKGAEIQPFDR
FT                   DGALPRLAEVSGEAQQAGVIARWLGEFADAGYQTTAVLTKTQAEAERLAKALERLGVKL
FT                   RRLDKRAVSLEPGVVVAPVYLAKGVEFDGVIVANVSREQYQTALDRQLLYTACTRAMHE
FT                   LRMVSVGEASPWILSQPADTYERVDAAEVNAT"
FT                   /protein_id="YP_003183536.1"
     ATGGAAGGAC AACCATCAGC ACGCCACCCC GACTGGGAGT CGGAACAAGC CTACGTCGAT        60
     CGCGTCGTGG CCGCCATGCG CGCCAAGCTC GCGGAGCTTG AAGGCGTCTT GCGCGGCGTG       120
     CGCGGCGAGA TCGTCGAATT TCGCCGGCAC TTCTGGGACG ACGTCACCAT CAACCTGAGC       180
     ACCCTGGACG ATCTCGTCGA AACCCACTTC GCCATCCGCC AGCAGGCGGA AGTCCTCGGC       240
     GAACGGGAGC GGCGTTATCA GCAGGCGGCG AAGACGAAGC GCACGCTGGA ACGCCAGATT       300
     TCGTCGCCGT TTTTTGCGCG AATCGACTTT CGATATGAGG GCGAGCGCGA GGCCGAGCCC       360
     ATCTACATCG GAATCGCGTC GTTTCGCGAC GAGCGCGATC AGACGTTCCT CGTGCACGAC       420
     TGGCGCGCGC CCATCTCGAG CGTCTACTAC GACGCGCTGC CGGGACCGGC GTCGTTCAAG       480
     GCGCCGGCTG GGATCGTGCG GGGCGAGCTG ACACTGAAGC GCCAGTTCGT CATCCGCGGC       540
     GGCGCTATCC TTGCGATGTT CGACGCAGGG CTGACCATTG GGGACGAGCT CCTCATGTAC       600
     GCCCTGTCGC GCCGTTCCGA CGCGCAGATG CACAACATTG TCGCGACCAT CCAGCGCCAG       660
     CAGAACGTCG TCATCCGCGA CGACGAGTCT CCGGCGCTCC TCGTCACCGG CGCGGCCGGC       720
     AGTGGCAAGA CGTCGGCCGC TCTGCAGCGC GCCGCGTATC TTTTGTACAA GCACCGGGGC       780
     GATCTCGACG CGCGCCAGAT GCTCTTTTTC TCGCCGAACC CGCTTTTCAT GTCGTACATC       840
     TCGAACGTGT TGCCCGAGCT CGGCGAGGAC AACATCGAAC AGGCGACGTT CTACGACTAT       900
     CTCTGCGCCA GGCTTCAGGA CGAGTTCGTC GTCGAGGATC CCTTCGATCA GATGGAGCGC       960
     CTGCTCGAGG CGGGCGAGGA CAGCCGCATG GCGAGGGCCG TGCGGTACAA GGCGTCGAAG      1020
     GCGTTCGCGG ACGAGATCGA CCGGTACGTC GCCGGCCTCG CGCCGCAGAT GCGCTTCCAT      1080
     CCCATTCTGG TGGAGGGGCG CGTCATCGCG ACGGCGACCG ACGTCAAGGC GGCGTTCGAC      1140
     AGGACGGATC CAGGGCTTCG CCTCCCGCTT CGCGTCGATC TCGTCAAGGA GGAGCTCTTG      1200
     AATCGCCTGC GCCAGTTCGA GCGCGACGAG GCGCTTTCCG ACTGGGTGCA GAAAGCCGTG      1260
     GACGGGCTGC CGGACGAGGC GTACCGGCGC GCGGAGCGCA CGGCAGCCAA GCGCAAGCGC      1320
     GAGCGCCCCG ATCTCGATGA GCAGGAGGAG GCGCGCCGGC TGCTCGGACG CGAGGTGCTT      1380
     CGCCGGATGC TTCGGCCCGT GCGCCGCTTC GTGGAGACGC TTCGCTTCGT GGACACGGCG      1440
     GGGATGTACC GCGCTTGGTT CGAACAGGCG GCGTCGAGTC CGCCGGAGGG CTTTCAATCG      1500
     GAGGACTGGG CGCAGATCTG CCGCCAGACC GTGCGCGAGA TGGACGAGGG CACGCTCTGG      1560
     TACGAGGACG CGACCCCGTA CCTGTATATG AAGGAGCAGA TCCTCGGCCG CGCGGTGAGC      1620
     GCGCCCATCC GGCACGTTTT GGTGGACGAG GTGCAGGACT ACTCCGTGCT TCAGCTGCGC      1680
     CTCATCCGCA GCCTCTTCCC CTACAGCCGC ATCACGATGC TCGGAGATCC AGAGCAGCTC      1740
     GTGTCGCCCC ATCGCCCCGG CATCCTCGAG GAGGACGAGA TGGCGCGGCT CTTCCCCGGG      1800
     CTCGTCCGGG TGGCGTTTGG ACAGAGCTAC CGCTCGACGC GGCAGATTGT CCTGTTCACG      1860
     CGCGGCATGG TGCCGAAGGG CGCAGAGATT CAGCCGTTCG ATCGCGACGG CGCGCTGCCG      1920
     CGGCTGGCGG AGGTGTCCGG AGAGGCGCAG CAGGCGGGCG TGATCGCGCG GTGGCTCGGC      1980
     GAGTTTGCGG ATGCGGGGTA CCAGACGACG GCGGTGCTGA CCAAGACGCA GGCCGAGGCG      2040
     GAGCGGCTGG CCAAAGCGCT GGAGCGGCTC GGCGTGAAGC TTCGGCGCCT CGACAAGCGC      2100
     GCGGTGAGCC TCGAGCCGGG CGTCGTGGTG GCGCCGGTGT ATCTGGCGAA AGGCGTCGAG      2160
     TTCGACGGCG TCATCGTCGC GAACGTGTCG CGGGAACAGT ACCAAACCGC GTTGGATCGG      2220
     CAACTGCTGT ACACGGCCTG CACGCGCGCG ATGCACGAGC TTCGCATGGT GTCCGTGGGC      2280
     GAGGCGAGCC CGTGGATTCT CTCGCAGCCC GCGGACACGT ACGAGCGCGT GGACGCCGCA      2340
     GAGGTGAACG CGACGTGA                                                    2358
//

If you have problems or comments...

PBIL Back to PBIL home page