(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE83

ALIAD_1.PE83         Location/Qualifiers
FT   CDS_pept        106657..107280
FT                   /locus_tag="Aaci_0084"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /codon_start="1"
FT                   /product="Phosphoglycerate mutase"
FT                   /transl_table="11"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pca:Pcar_2741
FT                   phosphoglycerate mutase/fructose-2,6-bisphosphatase"
FT                   /db_xref="GI:258510103"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:8423546"
FT                   /translation="MKIYLFRHGQTVYNADGERFCGTSDVGLTALGWQQARRAARLIRG
FT                   VRPAAIVHSGLRRSLETAMAIRESLPGAADCPLVAHEGFREVGFGAWEGLTRAEVNRLY
FT                   PELYAEWLARPEEARIPGGDDLYERQQEAVDAFLDVVARYRDGDLVIVAHNTLNRLLIL
FT                   GLMGLDARHYRRIVQENACLNILEYHEEEGVRLHALNRVPEQDE"
FT                   /protein_id="YP_003183537.1"
     GTGAAGATCT ATCTCTTCCG CCATGGGCAG ACCGTGTACA ATGCGGACGG CGAGCGGTTC        60
     TGCGGCACCT CCGACGTGGG ACTGACCGCG CTCGGATGGC AGCAGGCCCG CCGCGCCGCG       120
     CGGCTCATCC GGGGCGTCCG CCCGGCGGCC ATCGTCCACT CCGGCCTGCG CCGATCGCTC       180
     GAGACCGCCA TGGCCATCCG CGAGTCGCTG CCCGGCGCCG CGGATTGCCC GCTCGTCGCC       240
     CACGAAGGAT TTCGCGAGGT CGGGTTTGGC GCCTGGGAGG GGCTGACTCG GGCCGAGGTG       300
     AATCGGCTGT ACCCGGAATT GTACGCCGAG TGGCTCGCCC GCCCGGAGGA GGCGCGCATT       360
     CCCGGCGGGG ACGACCTGTA CGAGCGTCAA CAGGAGGCCG TCGACGCCTT TTTGGACGTC       420
     GTGGCGCGCT ACCGCGACGG CGATCTCGTC ATCGTCGCCC ACAACACGCT CAACCGGCTG       480
     CTCATTCTCG GCCTCATGGG GCTCGACGCG CGTCACTATC GGCGCATTGT CCAGGAGAAC       540
     GCCTGCCTCA ACATCCTCGA GTACCACGAG GAGGAGGGCG TGCGGCTGCA CGCGCTCAAC       600
     CGTGTGCCGG AGCAGGACGA ATAG                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page