(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE84

ALIAD_1.PE84         Location/Qualifiers
FT   CDS_pept        107356..108630
FT                   /locus_tag="Aaci_0085"
FT                   /gene_family="HOG000100403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /codon_start="1"
FT                   /EC_number="5.3.1.9"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   dds:Ddes_0851 glucose-6-phosphate isomerase"
FT                   /db_xref="GI:258510104"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="GeneID:8423547"
FT                   /translation="MIELSLEKARKWFTEEHEARLAPLAQFALGELNNRDRDAFGKGWI
FT                   DWPAADHSALYRDVDAIAADFRAKSNATVVIGIGGSYLGAQSALSMAKPAFTGEGHHEV
FT                   IFAGQQLSPTYHAHLLQYLDKREVTLVVVSKSGTTLEPSAVFHTFREYLEKRYGVEEAN
FT                   RRICAITDAEKGSLRQFADERKYATLPIPDDIGGRYSVLTAVGLLPMALAGIDYKRVMQ
FT                   GAARMREELSKLKVADHPAVKYALARHVLYQQGFVAEALVTYEPRVADFAGWWQQLFGE
FT                   SQGKDGTGLFPTMLRYTTDLHSMGQYVQDARKILVETVLDVHFSDEPELVVPRGLDEKN
FT                   AYLDGVSFSRLQEVAVESVMVAHSEAGVPNILIRAKGDPESLYGELVYFFEVACAVGGY
FT                   LMGTNPFDQPGVEAYKNEMRSRLKA"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /protein_id="YP_003183538.1"
     GTGATCGAAC TATCCCTGGA GAAAGCGAGA AAATGGTTCA CGGAAGAACA CGAGGCGCGG        60
     CTTGCGCCCT TGGCCCAGTT CGCGCTCGGA GAGTTGAATA ACCGCGATCG CGATGCCTTC       120
     GGGAAAGGGT GGATCGACTG GCCGGCGGCG GATCACAGCG CGCTGTACCG CGATGTGGAC       180
     GCCATTGCGG CGGACTTTCG CGCGAAGTCG AATGCGACGG TCGTCATTGG CATTGGCGGG       240
     TCGTACCTGG GTGCGCAGTC GGCCCTGTCC ATGGCGAAGC CCGCGTTCAC GGGCGAGGGC       300
     CATCACGAGG TGATCTTCGC GGGGCAACAG CTCAGCCCGA CGTATCACGC GCACCTGCTC       360
     CAATACCTGG ACAAGCGCGA GGTCACGCTG GTCGTGGTGT CGAAGTCGGG CACGACGCTC       420
     GAGCCTTCCG CGGTCTTTCA CACGTTCCGC GAATACCTGG AAAAGCGGTA CGGTGTGGAG       480
     GAGGCCAACC GCCGCATCTG CGCCATCACG GACGCCGAGA AGGGCAGCCT GCGCCAGTTC       540
     GCGGACGAGC GGAAGTATGC GACACTGCCC ATCCCTGACG ACATCGGCGG GCGGTACTCG       600
     GTGCTCACGG CGGTCGGGCT TTTGCCGATG GCGCTCGCCG GGATCGACTA CAAGCGCGTG       660
     ATGCAGGGCG CGGCTCGCAT GCGCGAAGAG CTCTCGAAGC TCAAGGTGGC GGATCATCCG       720
     GCGGTGAAGT ACGCGCTTGC GCGCCACGTG CTGTACCAGC AGGGCTTCGT GGCGGAAGCG       780
     CTTGTGACGT ACGAGCCGCG CGTCGCGGAT TTCGCCGGAT GGTGGCAGCA GTTGTTCGGC       840
     GAGAGCCAGG GCAAGGACGG CACCGGGCTT TTCCCCACGA TGCTGCGGTA CACGACGGAT       900
     CTGCACTCCA TGGGCCAATA CGTGCAGGAC GCGCGCAAGA TCCTCGTGGA GACGGTGCTC       960
     GACGTCCATT TCTCGGACGA GCCGGAGCTC GTGGTGCCGC GCGGCCTGGA CGAGAAAAAC      1020
     GCGTATCTGG ACGGCGTCTC GTTCTCGCGG CTGCAGGAGG TGGCCGTCGA GTCGGTGATG      1080
     GTGGCCCACA GTGAGGCCGG CGTGCCGAAC ATCCTAATTC GGGCGAAGGG AGATCCGGAG      1140
     TCGCTCTACG GCGAACTGGT CTACTTCTTT GAGGTGGCCT GCGCGGTCGG GGGGTACCTC      1200
     ATGGGCACCA ACCCGTTCGA CCAGCCGGGC GTCGAGGCGT ACAAGAACGA GATGCGATCG      1260
     CGCTTGAAGG CGTAA                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page