(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE85

ALIAD_1.PE85         Location/Qualifiers
FT   CDS_pept        108654..109595
FT                   /locus_tag="Aaci_0086"
FT                   /gene_family="HOG000150087" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00744"
FT                   /codon_start="1"
FT                   /product="glucokinase, ROK family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glucokinase, ROK family; PFAM: ROK family
FT                   protein; KEGG: mlo:mlr7234 glucose kinase"
FT                   /db_xref="GI:258510105"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="GeneID:8423548"
FT                   /translation="MEQKLALGIDIGGTNVKLAIVRSDGRVLVDRSIPTAPERGPEAFS
FT                   RTVGAEARAMANEASVAWDSVVGAGVGMAGFLDVERGWVEEAVNLHWRDVPLADLLQSA
FT                   LDKPVRVDNDANVAALGEVWLGAGQNAHTALCVTLGTGVGGGIVIGGRIHRGASTMAGE
FT                   IGHIMVKNDGELCNCGHRGCLETLASATALVRHAVAAGVKSPGGGELTAKEVFALAAEG
FT                   DPAARAVVDDMIHWLAVGLAVVANILNPDVIVVAGGLVNAGDQLMEPLRAAFQREALAR
FT                   VARACRLVPAKLGDQAGVLGAARLVLQDIESL"
FT                   /protein_id="YP_003183539.1"
     ATGGAACAGA AGCTTGCGCT TGGCATCGAC ATTGGCGGCA CGAACGTGAA GTTGGCCATC        60
     GTGCGAAGCG ATGGCCGCGT GTTGGTGGAC AGGTCCATCC CCACGGCTCC CGAGCGGGGG       120
     CCGGAGGCCT TCTCCCGCAC GGTCGGCGCA GAGGCTCGTG CCATGGCGAA CGAGGCGTCC       180
     GTGGCGTGGG ACTCCGTCGT GGGCGCGGGC GTGGGCATGG CGGGCTTTCT GGATGTGGAG       240
     CGCGGATGGG TGGAGGAAGC CGTCAACTTG CACTGGCGGG ATGTTCCCCT CGCGGATCTG       300
     CTTCAGTCGG CGCTAGACAA ACCTGTTCGC GTGGACAACG ACGCCAACGT CGCGGCCCTC       360
     GGCGAGGTGT GGCTCGGCGC GGGGCAGAAC GCGCACACCG CCCTCTGCGT CACGCTCGGC       420
     ACGGGCGTCG GCGGCGGTAT TGTCATTGGG GGGCGCATCC ACCGCGGTGC CTCGACCATG       480
     GCCGGTGAAA TCGGTCACAT CATGGTGAAA AACGACGGGG AGCTTTGCAA CTGCGGCCAC       540
     CGCGGCTGCC TGGAGACCCT CGCCTCGGCC ACCGCGCTCG TGCGCCACGC CGTCGCGGCT       600
     GGGGTGAAGA GTCCAGGTGG GGGGGAACTC ACCGCGAAAG AGGTCTTTGC GCTGGCCGCG       660
     GAGGGCGATC CGGCCGCGCG CGCGGTCGTC GACGACATGA TTCACTGGCT GGCGGTGGGG       720
     CTCGCGGTCG TGGCCAACAT CCTGAACCCG GACGTCATTG TCGTCGCCGG CGGGCTCGTG       780
     AACGCGGGAG ATCAGCTCAT GGAGCCGCTT CGTGCCGCGT TTCAGCGGGA AGCGCTGGCC       840
     CGAGTCGCGC GCGCGTGCAG ATTGGTCCCC GCGAAACTCG GGGATCAGGC CGGCGTCCTG       900
     GGCGCCGCCC GGCTGGTGCT GCAGGATATC GAAAGCCTGT GA                          942
//

If you have problems or comments...

PBIL Back to PBIL home page