(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE87

ALIAD_1.PE87         Location/Qualifiers
FT   CDS_pept        109981..110310
FT                   /locus_tag="Aaci_0088"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510107"
FT                   /db_xref="GeneID:8423550"
FT                   /translation="MGHVHMIFGVILIILAILATAWEIAAQRGLPRALRGVVIGLFDLQ
FT                   VLLGIITWIVRRPNWSFVFHPIIMIVAVIILHVMTSPSATRSRRLTGWIVATVLFIIGA
FT                   AIYHA"
FT                   /protein_id="YP_003183541.1"
     GTGGGACACG TGCACATGAT CTTCGGCGTC ATCCTCATCA TTCTGGCCAT CCTGGCGACG        60
     GCGTGGGAAA TTGCGGCGCA GCGCGGGCTG CCTCGAGCGC TGCGCGGTGT CGTCATCGGG       120
     CTCTTTGACC TGCAGGTGTT GCTCGGCATC ATCACGTGGA TTGTGCGCAG GCCGAACTGG       180
     TCGTTTGTGT TCCATCCCAT CATCATGATC GTGGCGGTCA TCATCCTGCA CGTGATGACG       240
     TCACCTTCCG CCACCCGATC CCGCAGGTTG ACGGGATGGA TTGTCGCCAC GGTCTTGTTC       300
     ATCATCGGCG CGGCGATTTA TCACGCCTGA                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page