(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE89

ALIAD_1.PE89         Location/Qualifiers
FT   CDS_pept        110820..111047
FT                   /locus_tag="Aaci_0090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510109"
FT                   /db_xref="GeneID:8423552"
FT                   /translation="MAVKLHISTFQMPDGMYIATCAEIPMCRALRQNKGHAVQDVKQQI
FT                   RRFLAERQAENRPFEPEPLLEIEIEAPNGA"
FT                   /protein_id="YP_003183543.1"
     ATGGCCGTGA AGCTTCACAT CTCGACGTTT CAGATGCCGG ACGGTATGTA CATAGCTACG        60
     TGCGCAGAGA TCCCCATGTG CCGGGCGCTG CGGCAGAACA AGGGACACGC GGTGCAGGAC       120
     GTGAAGCAGC AGATCCGGCG CTTTCTCGCG GAGCGGCAGG CGGAGAATCG TCCGTTTGAG       180
     CCGGAGCCGC TGTTGGAAAT TGAAATTGAA GCGCCGAATG GCGCTTGA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page