(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE90

ALIAD_1.PE90         Location/Qualifiers
FT   CDS_pept        complement(111332..113470)
FT                   /locus_tag="Aaci_0091"
FT                   /gene_family="HOG000072128" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /codon_start="1"
FT                   /product="MMPL domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="GI:258510110"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="GeneID:8423555"
FT                   /translation="MHRFEPKVRTWSRTWRAAAILGWLLAAALLAAVFPAASKEEINRS
FT                   TLLPASAPSQMATARVRDAFPASSGTPAILVFYDPTGISSADWAAIRRTVRELRTHPVT
FT                   AQTQVPPLDALPSGAAARFASDDGKVVSFPVLLRADASQDQLNQAVDEIDQDLRRAVGA
FT                   GALNLALDRPGLHAYVTGPAGIAVDATHLFQHADLALLIATTLLVLALMIVLYRSPILA
FT                   LVPLVSVGIAYAVVSSLLGAWARYGGLTFDAQTLSILTVLLFGAGTDYCLFLIARYRQE
FT                   LRRHERPIDALRAGYKSAAGAILMSGLTVSASLLSLLAARSPSFHEFAIPFSVAVFVMA
FT                   LVAITFVPALIGSLGRAAFWPRIPRYEPDAPDAGRPGRVSRWLGRTAVRRRKPVAVLGS
FT                   LALAACCLALPHVRTSYDLLSSFPADMPSREGYAVLSAHESPGALAPIDVLVEGGSPEG
FT                   AVRAVQSLAAVEQVHLVAVRDHAHVALMQVELRTNPYSETAMAALSSIERAAAKGASAG
FT                   GQAAHVFLAGETAAQEDTRAITARDTRVVIPIVLVAIGLLLLVYLRSVVAPLYLLATIV
FT                   LSYGAAMGLGWLVIREVLHQPAMQGAIPLYAFVFLVALGEDYNIFVMSRIWEVWRRGQA
FT                   DAAVERGVADTASVITSAGLILAGTFAMLASLPIQVLLQFGVVTAIGVLLDTFVVRPWM
FT                   VPAITALLGDAARWPRRT"
FT                   /protein_id="YP_003183544.1"
     ttgcatcgat tcgaaccgaa agtccgaacg tggagccgga cctggcgcgc ggcggctatc        60
     ctcggatggc tcctcgccgc tgccttgctc gccgcggtct tccccgcggc gtccaaagag       120
     gagatcaacc gctccacgct tctgcccgcc tcggctccca gccagatggc aaccgcccga       180
     gtgcgggatg cgttccccgc atcgtccggc acgcccgcca tcctcgtctt ctacgatccg       240
     accggcatct cctccgccga ttgggctgcc attcgccgga ccgtccgcga acttcgcacg       300
     catcccgtga cggcacaaac gcaggtgccc ccgctcgatg cgctcccgtc cggagctgcg       360
     gcgcgcttcg cctcggatga cggcaaagtg gtgagcttcc ccgtgctcct gcgcgcggac       420
     gcatcgcagg accagctgaa tcaagccgtg gacgagatcg atcaggacct ccgccgcgcc       480
     gtcggcgccg gcgcgctcaa tctcgcactg gaccgtcccg gcctgcacgc ctacgtgaca       540
     gggccagcag gcattgcagt cgacgccacg catctgttcc agcacgccga tctcgccctg       600
     ctcatcgcca cgacgctgct cgtgctggca ctcatgatcg ttctgtaccg ctcgcccatc       660
     ctggccttgg tgccgctcgt gagcgtcggg atcgcatacg ccgtcgtgag ctcgctgctt       720
     ggcgcgtggg cgcgttacgg gggcctgacc ttcgacgcgc agaccctgtc tatcctgacg       780
     gtgctactgt ttggcgccgg aacggattac tgcctgttcc tcatcgcccg ctaccgccag       840
     gagctgcggc gtcatgagcg gccgatcgac gccttgcgcg ctggctacaa aagcgcggca       900
     ggtgccattc tgatgagcgg cctgacggtg tccgcttcgc ttctgtcact gttggcggcg       960
     cgatcgccgt cctttcacga gttcgcgatc cccttcagcg tcgcggtatt cgtgatggcc      1020
     ctcgtcgcca tcaccttcgt gccggcgctc attggctcgc ttgggcgcgc ggcgttttgg      1080
     ccacgaattc cccgctatga accagatgcg ccggacgcag ggcggccagg gcgcgtctcg      1140
     cgctggctcg ggcggacagc ggtgcggcgg cgcaagccgg tggccgtcct tggctcgctc      1200
     gccctcgccg cctgctgcct cgccctgcca cacgtgcgca cgagctacga tctgctctcg      1260
     tccttcccgg cggacatgcc ttcgcgcgaa ggctacgccg tgctgtcggc ccacgagagc      1320
     ccaggcgcgc tcgcgcccat cgacgtgctg gtcgagggcg ggagccccga aggtgccgtc      1380
     cgcgccgtgc aatcgctcgc cgccgtcgag caggtgcacc tggtggcggt ccgtgaccat      1440
     gcccacgtgg ccttgatgca ggtggagctg cgaacgaacc cctatagcga aaccgccatg      1500
     gcggcgctgt catccatcga gcgagctgcg gccaagggcg cttcagcggg tgggcaagcc      1560
     gcgcacgtct tcctggccgg cgaaaccgcc gctcaagaag acacgcgagc gatcacggct      1620
     cgagacacgc gggtggtcat ccccattgtg cttgtcgcca ttgggctcct cctgctcgtc      1680
     tatttgcggt cggtcgtcgc gccgctctat ctcctcgcga ccatcgtgct ctcctacggc      1740
     gccgccatgg gccttggttg gctcgtgatt cgtgaggtcc tccatcagcc cgccatgcag      1800
     ggggctatcc cgctttacgc gttcgtcttt ctagtggcac tcggcgaaga ttacaacatc      1860
     ttcgtcatgt cgcgcatctg ggaggtctgg cgccggggac aggctgacgc cgccgtggaa      1920
     cggggcgtcg ccgacacggc aagcgtcatt acttctgccg gcctcatcct ggcaggcacg      1980
     tttgccatgc tcgcgtccct gccgattcag gtcctgcttc agttcggcgt cgtcacggcc      2040
     atcggcgtgc tgctggacac cttcgtggtg cggccttgga tggtccccgc catcaccgcg      2100
     cttctcggag acgcggcgcg gtggccgagg cgcacctag                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page