(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE91

ALIAD_1.PE91         Location/Qualifiers
FT   CDS_pept        113595..114218
FT                   /locus_tag="Aaci_0092"
FT                   /gene_family="HOG000090092" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dac:Daci_0033
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:258510111"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:8423556"
FT                   /translation="MRNARSRRPGRPPQVEMEEPTAEKILRAAAECFMDQGFAAVSMDD
FT                   VAERAGVTKAVVYYYYGSKTELFQRAMMEVMRASRERTQAILRENGPLRERLQKLTRTR
FT                   LAIPATLDMNHILRGSQRALRPDQVDEMHRAEEQLVEVIAQELHAEMEQGRLRPVDAMF
FT                   VARSYLALLGMGQAEIRRRGGGQAAIDEIAEEIVDLLWRGIEPR"
FT                   /protein_id="YP_003183545.1"
     ATGCGGAACG CGAGGAGCCG GCGACCTGGG CGCCCGCCGC AGGTGGAGAT GGAGGAGCCG        60
     ACGGCTGAAA AAATTCTCCG CGCGGCTGCT GAGTGCTTCA TGGATCAGGG ATTCGCGGCG       120
     GTTTCGATGG ACGACGTCGC GGAACGAGCT GGCGTCACGA AGGCTGTCGT GTATTACTAT       180
     TATGGTTCCA AGACGGAGCT GTTTCAGCGC GCGATGATGG AGGTCATGCG CGCTTCCCGC       240
     GAGCGCACGC AGGCCATTCT GCGCGAGAAC GGGCCGCTGC GCGAGCGGCT GCAGAAGCTC       300
     ACGCGGACCC GCCTTGCCAT TCCAGCGACG CTCGACATGA ACCACATCCT TCGGGGCAGT       360
     CAACGCGCGC TTCGCCCGGA CCAAGTGGAC GAGATGCACA GAGCGGAAGA GCAGCTGGTG       420
     GAAGTCATCG CCCAAGAATT GCACGCGGAG ATGGAACAGG GGCGCTTGCG GCCGGTGGAC       480
     GCCATGTTCG TGGCGCGCTC GTACCTCGCG CTTCTCGGCA TGGGGCAGGC GGAGATCCGG       540
     CGTCGCGGTG GAGGACAAGC CGCCATCGAC GAGATTGCGG AAGAAATCGT GGATCTGCTG       600
     TGGCGCGGGA TTGAGCCGCG GTGA                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page