(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE92

ALIAD_1.PE92         Location/Qualifiers
FT   CDS_pept        114330..114440
FT                   /locus_tag="Aaci_0093"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510112"
FT                   /db_xref="GeneID:8423557"
FT                   /translation="MYGVFGGYTRWAVVFLIIFVLFFLFVPAAPVATASC"
FT                   /protein_id="YP_003183546.1"
     ATGTACGGTG TGTTTGGTGG GTACACCCGT TGGGCGGTCG TGTTCCTGAT CATCTTCGTG        60
     CTGTTCTTCC TGTTCGTCCC GGCTGCGCCG GTTGCGACGG CGTCCTGCTG A                111
//

If you have problems or comments...

PBIL Back to PBIL home page