(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE93

ALIAD_1.PE93         Location/Qualifiers
FT   CDS_pept        complement(114562..115107)
FT                   /locus_tag="Aaci_0094"
FT                   /gene_family="HOG000201072" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03079"
FT                   /codon_start="1"
FT                   /product="Acireductone dioxygenase ARD"
FT                   /transl_table="11"
FT                   /note="PFAM: Acireductone dioxygenase ARD; Cupin 2
FT                   conserved barrel domain protein; KEGG: dda:Dd703_0920
FT                   acireductone dioxygenase ARD"
FT                   /db_xref="GI:258510113"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:8423558"
FT                   /translation="MVAYVRIRNTGEEIRGEDQVREFLNRNEVYYDHWDVDRKLPEALK
FT                   GKFDLSDAEKDEILQALQEEIQDLSRKRGYVKWDVISLSESTPNLDELLKKFEQVHTHT
FT                   EDEVRAIVSGSGIFIIKGKDGGYFDVVLSAGDVISVPEGNPHFFTLTDERKVVAVRLFI
FT                   DPAGWVAHPYEDPAFQQA"
FT                   /protein_id="YP_003183547.1"
     gtggtggcat acgtacggat tcgcaacacg ggcgaagaaa tccgcggcga ggaccaggtt        60
     cgcgagttcc tgaaccgcaa tgaggtctat tacgatcact gggacgtcga tcggaagctg       120
     ccggaggcgc tgaagggcaa gttcgatctt tcagacgcgg aaaaggacga gattcttcag       180
     gccctgcagg aggagatcca ggacctctcc cgcaagcggg gctacgtgaa gtgggacgtc       240
     atttcgcttt cggagtcgac gcccaacttg gatgaactct tgaagaagtt cgagcaggtc       300
     cacacacaca ccgaggacga ggtccgcgcc atcgtgtcgg gtagcggcat cttcatcatc       360
     aaggggaaag acggcggcta cttcgacgtg gtgttgagcg ccggtgacgt gatctctgtc       420
     ccggagggca acccgcactt cttcacgctc accgacgagc ggaaggtggt ggccgtccgc       480
     ctgttcatcg atccggcggg atgggtcgcg catccgtacg aggaccctgc atttcaacag       540
     gcgtga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page