(data stored in SCRATCH zone)

HOGENOMDNA: ALISL_4

ID   ALISL_4; SV 1; empty ; DNA; empty ; PRO; 30807 BP.
XX
AC   NC_011314;
XX
PR   Project: 59251;
XX
DE   Aliivibrio salmonicida LFI1238 plasmid pVSAL320, complete sequence.
XX
OS   Aliivibrio salmonicida LFI1238
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Aliivibrio.
XX
RN   [1]
RP   1-30807
RX   PUBMED; 19099551.
RA   Hjerde,E., Lorentzen,M.S., Holden,M.T., Seeger,K., Paulsen,S., Bason,N.,
RA   Churcher,C., Harris,D., Norbertczak,H., Quail,M.A., Sanders,S.,
RA   Thurston,S., Parkhill,J., Willassen,N.P. and Thomson,N.R.;
RT   "The genome sequence of the fish pathogen Aliivibrio salmonicida strain
RT   LFI1238 shows extensive evidence of gene decay";
RL   BMC Genomics 9, 616 (2008)
XX
RN   [2]
RP   1-30807
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (02-OCT-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-30807
RA   Hjerde,E.;
RT   "Direct Submission";
RL   Submitted (26-JUN-2008) Hjerde E., Department of Molecular Biotechnology,
RL   University of Tromso, Breivika, 9037 Tromso, NORWAY
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from FM178382.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..30807
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:316275"
FT                   /country="Norway:Hammerfest"
FT                   /isolation_source="Atlantic cod"
FT                   /strain="LFI1238"
FT                   /plasmid="pVSAL320"
FT                   /organism="Aliivibrio salmonicida LFI1238"
FT   gene            complement(127..336)
FT                   /old_locus_tag="pVSAL320_01"
FT                   /db_xref="GeneID:6962653"
FT                   /locus_tag="VSAL_p320_01"
FT   CDS_pept        complement(127..336)
FT                   /locus_tag="VSAL_p320_01"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_01"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967945"
FT                   /db_xref="GeneID:6962653"
FT                   /translation="MNMTEKKYGSCWYKRICQAYIIKKYEIYGYTSLDKLSEWNRLVPK
FT                   RQEGEFSCRKEYQYINPLDGRKDN"
FT                   /protein_id="YP_002265371.1"
FT   gene            complement(417..1130)
FT                   /old_locus_tag="pVSAL320_02"
FT                   /db_xref="GeneID:6962622"
FT                   /locus_tag="VSAL_p320_02"
FT   CDS_pept        complement(417..1130)
FT                   /locus_tag="VSAL_p320_02"
FT                   /gene_family="HOG000012322" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_02"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967946"
FT                   /db_xref="GeneID:6962622"
FT                   /translation="MKKNQPLTKLTLFVISILTTCVANASIELTLDDVKFDKNTGTILG
FT                   YVSSYTDIIIPEQFQHISVTSIGDSAFSFHHLKKVIIPNSVKIIHDSAFTQNELTSVTI
FT                   PDSVITIGNSVFSYNQLTRVKVPDLVTTIGNRTFANNKLTSVDIPNSVITIDDSAFFYN
FT                   KLTHVIIPNSVTTIGNKAFFNNQLTNITIPNSLINIGNNAFHANKLITVSIPNSMTTTA
FT                   HNLFDEEVIITRASL"
FT                   /protein_id="YP_002265372.1"
FT   sig_peptide     complement(1056..1130)
FT                   /old_locus_tag="pVSAL320_02"
FT                   /locus_tag="VSAL_p320_02"
FT   gene            1404..2033
FT                   /old_locus_tag="pVSAL320_03"
FT                   /db_xref="GeneID:6962623"
FT                   /locus_tag="VSAL_p320_03"
FT   CDS_pept        1404..2033
FT                   /locus_tag="VSAL_p320_03"
FT                   /gene_family="HOG000275579" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to sequence:UniProt:P22996"
FT                   /old_locus_tag="pVSAL320_03"
FT                   /codon_start="1"
FT                   /product="resolvase"
FT                   /transl_table="11"
FT                   /note="Similar to Escherichia coli Resolvase parA
FT                   UniProt:P22996 (219 aa) fasta scores: E()=1.6e-17, 38.308%
FT                   id in 201 aa"
FT                   /db_xref="GI:209967947"
FT                   /db_xref="GeneID:6962623"
FT                   /translation="MYIFGYLRASTKEQDAKRAQDSLKSFAEDKGARIAGWYIENVSGA
FT                   SLQRPELMRLLKDAEKGDAILIEQVDRLSRLNDEDWETLKALINKKQLKVISLDLPTSH
FT                   TVLMKHHNDDFTSAMFRAINNMMLDMLAAIARKDYQDRRRRQEQGIERAKVEGFYRGRR
FT                   PDLDMHEKIIQLRVHNQLSVNATAKLVGVTARTVIRIVKIYNEDRV"
FT                   /protein_id="YP_002265373.1"
FT   misc_feature    1410..1850
FT                   /old_locus_tag="pVSAL320_03"
FT                   /note="Serine recombinase (SR) family, Partitioning
FT                   (par)-Resolvase subfamily, catalytic domain; Serine
FT                   recombinases catalyze site-specific recombination of DNA
FT                   molecules by a concerted, four-strand cleavage and
FT                   rejoining mechanism which involves a transient...; Region:
FT                   SR_Res_par; cd03767"
FT                   /locus_tag="VSAL_p320_03"
FT                   /db_xref="CDD:58116"
FT   misc_feature    order(1425..1427,1431..1433,1614..1619,1626..1628)
FT                   /old_locus_tag="pVSAL320_03"
FT                   /note="catalytic residues; other site"
FT                   /locus_tag="VSAL_p320_03"
FT                   /db_xref="CDD:58116"
FT   misc_feature    1431..1433
FT                   /old_locus_tag="pVSAL320_03"
FT                   /note="catalytic nucleophile; other site"
FT                   /locus_tag="VSAL_p320_03"
FT                   /db_xref="CDD:58116"
FT   misc_feature    1410..1880
FT                   /old_locus_tag="pVSAL320_03"
FT                   /note="HMMPfam hit to PF00239, Resolvase, N terminal
FT                   domain, score 6.2e-24"
FT                   /locus_tag="VSAL_p320_03"
FT                   /inference="protein motif:HMMPfam:PF00239"
FT   misc_feature    1419..1445
FT                   /old_locus_tag="pVSAL320_03"
FT                   /note="PS00397 Site-specific recombinases active site."
FT                   /locus_tag="VSAL_p320_03"
FT                   /inference="protein motif:ProSite:PS00397"
FT   misc_feature    1587..1625
FT                   /old_locus_tag="pVSAL320_03"
FT                   /note="PS00398 Site-specific recombinases signature 2."
FT                   /locus_tag="VSAL_p320_03"
FT                   /inference="protein motif:ProSite:PS00398"
FT   misc_feature    1944..2010
FT                   /old_locus_tag="pVSAL320_03"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1241.000, SD 3.41 at aa 181-202, sequence
FT                   LSVNATAKLVGVTARTVIRIVK"
FT                   /locus_tag="VSAL_p320_03"
FT   gene            complement(2052..2363)
FT                   /old_locus_tag="pVSAL320_04"
FT                   /db_xref="GeneID:6962624"
FT                   /locus_tag="VSAL_p320_04"
FT   CDS_pept        complement(2052..2363)
FT                   /locus_tag="VSAL_p320_04"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_04"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967948"
FT                   /db_xref="GeneID:6962624"
FT                   /translation="MFDISDLTIKELIELNDRITERLRELESLKNSVLMDNFRLGDPVF
FT                   FIPPNGSKVCGIVIKKNQKTISVLDDSGNSWNVPPMHLVSQGTENVFDVDWEKNVKSK"
FT                   /protein_id="YP_002265374.1"
FT   gene            complement(2356..2643)
FT                   /old_locus_tag="pVSAL320_05"
FT                   /db_xref="GeneID:6962625"
FT                   /locus_tag="VSAL_p320_05"
FT   CDS_pept        complement(2356..2643)
FT                   /locus_tag="VSAL_p320_05"
FT                   /gene_family="HOG000293081" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to sequence:UniProt:Q5DYK6"
FT                   /old_locus_tag="pVSAL320_05"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Similar to Vibrio fischeri Hypothetical protein
FT                   UniProt:Q5DYK6 (80 aa) fasta scores: E()=1.7e-22, 76.923%
FT                   id in 78 aa. Orthologues are identified on chromosomal DNA
FT                   in other vibrios"
FT                   /db_xref="GI:209967949"
FT                   /db_xref="GeneID:6962625"
FT                   /translation="MRKSIRFYDDVHFPKGFNRKGFTIKEAAVLDNYGLTMKGLLDGSL
FT                   MPDSDEEKLFLLGVKNEDKSVSLFVQCWLKYSDLITKKPKLHTLCGNPYV"
FT                   /protein_id="YP_002265375.1"
FT   misc_feature    complement(2371..2643)
FT                   /old_locus_tag="pVSAL320_05"
FT                   /note="Protein of unknown function, DUF; Region: DUF413;
FT                   cl10479"
FT                   /locus_tag="VSAL_p320_05"
FT                   /db_xref="CDD:175222"
FT   misc_feature    complement(2359..2643)
FT                   /old_locus_tag="pVSAL320_05"
FT                   /note="HMMPfam hit to PF04219, Protein of unknown function,
FT                   DUF, score 2.8e-10"
FT                   /locus_tag="VSAL_p320_05"
FT                   /inference="protein motif:HMMPfam:PF04219"
FT   gene            complement(2975..3964)
FT                   /old_locus_tag="pVSAL320_06"
FT                   /db_xref="GeneID:6962626"
FT                   /locus_tag="VSAL_p320_06"
FT   CDS_pept        complement(2975..3964)
FT                   /locus_tag="VSAL_p320_06"
FT                   /gene_family="HOG000076377" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_06"
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967950"
FT                   /db_xref="GeneID:6962626"
FT                   /translation="MNSTILKPICIVLSIATASLSAILTAQFMYGIGLAMGELILMTAL
FT                   GIVLDLAKCATPLFVLFLFSQKQYASALFALVLSMTLSVVSFSASVAALEQGVVASQKN
FT                   STAYQAVSQQIKEYTTQVDELRLLAAKQQNANLITKSERTLEKIEPLLVRIDDLYQRQS
FT                   TLPSELTVFDKFGLLISYITSAALELMSWLLVLVSNALKRSHTHSNAVVRSHDKSSALE
FT                   LIQPDFIQTQLEIEPQSCAVNDEYFNDCVSEPVDCHEEEVFSDDHLKCNEQVYLEIKQA
FT                   VLAKEVKPSQRGIGERFKGVGRDTINFVLMDLKHAGFLRSYRKGYAFA"
FT                   /protein_id="YP_002265376.1"
FT   sig_peptide     complement(3887..3964)
FT                   /old_locus_tag="pVSAL320_06"
FT                   /locus_tag="VSAL_p320_06"
FT   misc_feature    complement(3374..3940)
FT                   /old_locus_tag="pVSAL320_06"
FT                   /locus_tag="VSAL_p320_06"
FT   gene            complement(4063..4302)
FT                   /old_locus_tag="pVSAL320_07"
FT                   /db_xref="GeneID:6962627"
FT                   /locus_tag="VSAL_p320_07"
FT   CDS_pept        complement(4063..4302)
FT                   /locus_tag="VSAL_p320_07"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_07"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967951"
FT                   /db_xref="GeneID:6962627"
FT                   /translation="MIEVFMKNNKVKIAPPSGKPTLVTDMPASSKASSGEETKNIQFKV
FT                   TPEKHNEIKSYAAERGLSLKELFLSFYENERMKE"
FT                   /protein_id="YP_002265377.1"
FT   gene            complement(4334..4969)
FT                   /old_locus_tag="pVSAL320_08"
FT                   /db_xref="GeneID:6962628"
FT                   /locus_tag="VSAL_p320_08"
FT   CDS_pept        complement(4334..4969)
FT                   /locus_tag="VSAL_p320_08"
FT                   /gene_family="HOG000219632" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_08"
FT                   /codon_start="1"
FT                   /product="DNA-binding protein, putative plasmid partition
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967952"
FT                   /db_xref="GeneID:6962628"
FT                   /translation="MIGTIMIISFLSQKGGVTKSTLARSIAVAFADNSWTVHIADMDWQ
FT                   QQTSCKWSARRDQKEIQPTITTSAHRRVESALKCEKSYNLLVIDGRPAADRDSIVIAKA
FT                   SSLIVLPTGTSLDDLEPQLHLANDLKMNGIPVDKIIFLINKSPTDSETNNAVETIKAWG
FT                   FNVCQTAIPFKAGYSSAQDQGLSITETRYPSLNKLTSKAIQEIVDLMI"
FT                   /protein_id="YP_002265378.1"
FT   misc_feature    complement(4343..4954)
FT                   /old_locus_tag="pVSAL320_08"
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /locus_tag="VSAL_p320_08"
FT                   /db_xref="CDD:134018"
FT   misc_feature    complement(4538..4951)
FT                   /old_locus_tag="pVSAL320_08"
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /locus_tag="VSAL_p320_08"
FT                   /db_xref="CDD:73302"
FT   misc_feature    complement(4910..4930)
FT                   /old_locus_tag="pVSAL320_08"
FT                   /note="P-loop; other site"
FT                   /locus_tag="VSAL_p320_08"
FT                   /db_xref="CDD:73302"
FT   misc_feature    complement(order(4703..4705,4910..4912))
FT                   /old_locus_tag="pVSAL320_08"
FT                   /note="Magnesium ion binding site; other site"
FT                   /locus_tag="VSAL_p320_08"
FT                   /db_xref="CDD:73302"
FT   misc_feature    complement(4889..4954)
FT                   /old_locus_tag="pVSAL320_08"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1109.000, SD 2.96 at aa 6-27, sequence
FT                   MIISFLSQKGGVTKSTLARSIA"
FT                   /locus_tag="VSAL_p320_08"
FT   gene            5190..5381
FT                   /old_locus_tag="pVSAL320_09"
FT                   /db_xref="GeneID:6962629"
FT                   /locus_tag="VSAL_p320_09"
FT   CDS_pept        5190..5381
FT                   /locus_tag="VSAL_p320_09"
FT                   /gene_family="HOG000076373" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_09"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967953"
FT                   /db_xref="GeneID:6962629"
FT                   /translation="MSVFKINYLNNEKTLLCSETILMKGLPAAKRSSSSMGTVKIEIYD
FT                   IAENLLTSKELGKWTVAE"
FT                   /protein_id="YP_002265379.1"
FT   gene            complement(5398..5991)
FT                   /old_locus_tag="pVSAL320_10"
FT                   /db_xref="GeneID:6962630"
FT                   /locus_tag="VSAL_p320_10"
FT   CDS_pept        complement(5398..5991)
FT                   /locus_tag="VSAL_p320_10"
FT                   /gene_family="HOG000245285" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_10"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967954"
FT                   /db_xref="GeneID:6962630"
FT                   /translation="MSKLKYHQAFTNLTTLALLHLYSYMEMSSRFVPMKKRSELLIKFL
FT                   KKQMALQGNAIIKKDIKVLITQARQGKNIEKKLGELHKVNCQYGEKFTDADHLFILLTY
FT                   LYEQHGFESTLDNSEIEREPGIIYTDSELIDTCFSDENILFRPLPLSVIMDEPSRLVDI
FT                   INGHGGMFIAEHLSTSIDNRCATVLLHKIPTPEK"
FT                   /protein_id="YP_002265380.1"
FT   misc_feature    complement(5482..5976)
FT                   /old_locus_tag="pVSAL320_10"
FT                   /note="Protein of unknown function (DUF2913); Region:
FT                   DUF2913; pfam11140"
FT                   /locus_tag="VSAL_p320_10"
FT                   /db_xref="CDD:151584"
FT   gene            complement(6403..6702)
FT                   /old_locus_tag="pVSAL320_11"
FT                   /db_xref="GeneID:6962631"
FT                   /locus_tag="VSAL_p320_11"
FT   CDS_pept        complement(6403..6702)
FT                   /locus_tag="VSAL_p320_11"
FT                   /gene_family="HOG000276615" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_11"
FT                   /codon_start="1"
FT                   /product="putative DNA-damage-inducible protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967955"
FT                   /db_xref="GeneID:6962631"
FT                   /translation="MIYFSCILYKNVLVIYTVNCEVIMRIEMILNSAFLPRNGTALIQQ
FT                   EMERRVWQRYPDARIRLRKGTSNHLEIYAPKNDKEAANKLIEEMFNDAEEWLYV"
FT                   /protein_id="YP_002265381.1"
FT   misc_feature    complement(6409..6576)
FT                   /old_locus_tag="pVSAL320_11"
FT                   /note="DinI-like family; Region: DinI; cl11630"
FT                   /locus_tag="VSAL_p320_11"
FT                   /db_xref="CDD:175323"
FT   misc_feature    complement(6409..6600)
FT                   /old_locus_tag="pVSAL320_11"
FT                   /note="HMMPfam hit to PF06183, DinI-like family, score
FT                   6.2e-16"
FT                   /locus_tag="VSAL_p320_11"
FT                   /inference="protein motif:HMMPfam:PF06183"
FT   gene            complement(7493..8353)
FT                   /old_locus_tag="pVSAL320_12"
FT                   /db_xref="GeneID:6962632"
FT                   /locus_tag="VSAL_p320_12"
FT   CDS_pept        complement(7493..8353)
FT                   /locus_tag="VSAL_p320_12"
FT                   /gene_family="HOG000005512" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_12"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967956"
FT                   /db_xref="GeneID:6962632"
FT                   /translation="MLSDVMMRMCLMSISDLLSKIQIKKQYDAEYRSKRKNRKHELIEL
FT                   HRSVVADENKKKPKTPFKFDFRSRRLLRSGKWEILPPEYARILKSCEEFIANPNRFPAL
FT                   NAWGGEGVNNIQCRRLVANVLACIIVNTDLIGGRIGLPTEAGLKTISYDHLQEDYALRF
FT                   GRFISPKSFAKAISYLKRAGYLHSERINVCVDLKEGTIRSAPAYKQFSERFFSDLKVVR
FT                   YSNICQLIIASRKRQEKKGLRFSWVSFRTLANGVQEVFNADKLNNVAQSVTAVFDAYLP
FT                   HPAPH"
FT                   /protein_id="YP_002265382.1"
FT   gene            complement(8744..9361)
FT                   /old_locus_tag="pVSAL320_13"
FT                   /db_xref="GeneID:6962633"
FT                   /locus_tag="VSAL_p320_13"
FT   CDS_pept        complement(8744..9361)
FT                   /locus_tag="VSAL_p320_13"
FT                   /gene_family="HOG000127685" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to sequence:UniProt:P14819"
FT                   /old_locus_tag="pVSAL320_13"
FT                   /codon_start="1"
FT                   /product="putative peptidase, S24-like"
FT                   /transl_table="11"
FT                   /note="Similar to Bacteriophage phi-80 Repressor protein CI
FT                   UniProt:P14819 (235 aa) fasta scores: E()=1.5e-07,29.060%
FT                   id in 234 aa"
FT                   /db_xref="GI:209967957"
FT                   /db_xref="GeneID:6962633"
FT                   /translation="MTTIGERIKSLRLNQGLSQESLAEKINVTKSTISQWEVGKAQPKN
FT                   KNLLSIVTFFDTTYEYLKGGGEIDDRCPRVVSVPFYNVSVAAGLGIINDSETYTYVDIE
FT                   NLQVSNIEHLVSLTASGDSMEPVLKDGSILVVDTQSKNIIDGHMYVFRQDDLLRVKLIS
FT                   YEKNHLIVTSYNKEYKDEMYKFSELDDLNIIGQVIWHSTKLN"
FT                   /protein_id="YP_002265383.1"
FT   misc_feature    complement(9176..9349)
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /locus_tag="VSAL_p320_13"
FT                   /db_xref="CDD:28977"
FT   misc_feature    complement(order(9248..9250,9323..9325,9335..9337))
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="non-specific DNA binding site; other site"
FT                   /locus_tag="VSAL_p320_13"
FT                   /db_xref="CDD:28977"
FT   misc_feature    complement(8747..9331)
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG2932"
FT                   /locus_tag="VSAL_p320_13"
FT                   /db_xref="CDD:32756"
FT   misc_feature    complement(order(9251..9253,9326..9328))
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="salt bridge; other site"
FT                   /locus_tag="VSAL_p320_13"
FT                   /db_xref="CDD:28977"
FT   misc_feature    complement(order(9245..9250,9260..9262,9269..9271,
FT                   9302..9307))
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /locus_tag="VSAL_p320_13"
FT                   /db_xref="CDD:28977"
FT   misc_feature    complement(8777..9013)
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /locus_tag="VSAL_p320_13"
FT                   /db_xref="CDD:119397"
FT   misc_feature    complement(order(8882..8884,8993..8995))
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="Catalytic site; other site"
FT                   /locus_tag="VSAL_p320_13"
FT                   /db_xref="CDD:119397"
FT   misc_feature    complement(8804..9010)
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24-like, score
FT                   7.1e-10"
FT                   /locus_tag="VSAL_p320_13"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    complement(9176..9340)
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   7.3e-16"
FT                   /locus_tag="VSAL_p320_13"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    complement(9248..9313)
FT                   /old_locus_tag="pVSAL320_13"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2387.000, SD 7.32 at aa 17-38, sequence
FT                   LSQESLAEKINVTKSTISQWEV"
FT                   /locus_tag="VSAL_p320_13"
FT   gene            9539..9706
FT                   /old_locus_tag="pVSAL320_14"
FT                   /db_xref="GeneID:6962634"
FT                   /locus_tag="VSAL_p320_14"
FT   CDS_pept        9539..9706
FT                   /locus_tag="VSAL_p320_14"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_14"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967958"
FT                   /db_xref="GeneID:6962634"
FT                   /translation="MSKNKKQGAIGLWFELDKETNHLLKLQAERNGRSKRAEALAIVKK
FT                   DIQQKLTNIR"
FT                   /protein_id="YP_002265384.1"
FT   gene            10109..10279
FT                   /old_locus_tag="pVSAL320_15"
FT                   /db_xref="GeneID:6962635"
FT                   /locus_tag="VSAL_p320_15"
FT   CDS_pept        10109..10279
FT                   /locus_tag="VSAL_p320_15"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_15"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967959"
FT                   /db_xref="GeneID:6962635"
FT                   /translation="MKMTPTEIREAVFIISLMREGHKPRPERIDGEAKKRIDDSTMHIA
FT                   SQAHSAINTWF"
FT                   /protein_id="YP_002265385.1"
FT   gene            10515..11087
FT                   /old_locus_tag="pVSAL320_16"
FT                   /db_xref="GeneID:6962636"
FT                   /locus_tag="VSAL_p320_16"
FT   CDS_pept        10515..11087
FT                   /locus_tag="VSAL_p320_16"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_16"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967960"
FT                   /db_xref="GeneID:6962636"
FT                   /translation="MFLVGEKEQHRPLLDMAELHALNATLSDITESDKDESQFVQKLVY
FT                   GRYKPQPDFHFPRSEVKRHINSAIGFCLAHISNTHVTYLNLDDIELIDVNLTASCGHCP
FT                   TPHKTNDIPFATLISCSSDFELNKRGAAKTVFLRCHNVDVQTDLLNRMGLFAFICEERN
FT                   YSSPVTKDNWTSRIDYRRATKRAQELR"
FT                   /protein_id="YP_002265386.1"
FT   misc_feature    11098..11361
FT                   /note="Similar to N-terminal part of Vibrio fischeri
FT                   Hypothetical protein UniProt:Q5DY82 (166 aa) fasta scores:
FT                   E()=7.2e-16, 53.261% id in 92 aa. CDS is truncated by the
FT                   insertion of the downstream IS element and subsequent
FT                   recombination events"
FT                   /inference="similar to sequence:UniProt:Q5DY82"
FT   repeat_region   11362..12800
FT                   /note="VSa9"
FT   gene            11555..12634
FT                   /old_locus_tag="pVSAL320_18"
FT                   /db_xref="GeneID:6962638"
FT                   /locus_tag="VSAL_p320_18"
FT   CDS_pept        11555..12634
FT                   /locus_tag="VSAL_p320_18"
FT                   /gene_family="HOG000266100" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to sequence:UniProt:Q5EJX2"
FT                   /old_locus_tag="pVSAL320_18"
FT                   /codon_start="1"
FT                   /product="putative transposase"
FT                   /transl_table="11"
FT                   /note="Identical to Aliivibrio salmonicida Plasmid pVS43
FT                   Putative transposase UniProt:Q5EJX2 (359 aa) fasta scores:
FT                   E()=2.3e-156, 99.721% id in 359 aa"
FT                   /db_xref="GI:209967961"
FT                   /db_xref="GeneID:6962638"
FT                   /translation="MLSCGTAAFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATE
FT                   RWIQKQQHVFPECEYQHITFTLPNTLWPIFRHNRWLLNKLFKCAANILLGWAKDKGIDV
FT                   GIFCALHTYGRKLNWNTHLHLSVTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGK
FT                   AYYELDLSSEECPYIRNKTDWSRFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPP
FT                   ISASRLSHYAKGGMITFNYLDHRTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFL
FT                   SMRHRGEALPRVYAALGMTIEAEPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVG
FT                   NSVNDLVTHAIVQSELRAA"
FT                   /protein_id="YP_002265387.1"
FT   misc_feature    11867..12412
FT                   /old_locus_tag="pVSAL320_18"
FT                   /note="Putative transposase; Region: Transposase_32;
FT                   pfam04986"
FT                   /locus_tag="VSAL_p320_18"
FT                   /db_xref="CDD:147256"
FT   misc_feature    11867..12424
FT                   /old_locus_tag="pVSAL320_18"
FT                   /note="HMMPfam hit to PF04986, Putative transposase, score
FT                   2.2e-50"
FT                   /locus_tag="VSAL_p320_18"
FT                   /inference="protein motif:HMMPfam:PF04986"
FT   gene            complement(13144..14130)
FT                   /old_locus_tag="pVSAL320_19"
FT                   /db_xref="GeneID:6962639"
FT                   /locus_tag="VSAL_p320_19"
FT   CDS_pept        complement(13144..14130)
FT                   /locus_tag="VSAL_p320_19"
FT                   /gene_family="HOG000141063" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_19"
FT                   /codon_start="1"
FT                   /product="putative antirestriction protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967962"
FT                   /db_xref="GeneID:6962639"
FT                   /translation="MTYSTAINSTITKETEATNVSSFEQSDSSKNEMGKKRKISRKRAV
FT                   VRVSKDIYQMVTDRIIAALENGVKPWACPWDRTNECSMLPMNFKTKTNYSGVNILLLWS
FT                   ETVEKGFTSPYWLTYKQANELGGNVIKGQKGTTIVYYKSWEKENEDGKIETIPMLKTFT
FT                   VFNIDQVDNIEKPVAMVKESREKNEFVTLNHVENAIKNTNMTINHCGVRAFYSPAHDEI
FT                   TLPMVDRFNSSYDYYATAWHELVHSTGHKTRLDRDLKNGFGSKDYAFEELIAELGAEFC
FT                   CADLGIVGDVQHESYIASWLERLNNDKKFIFKAASQASKAHQWLLKS"
FT                   /protein_id="YP_002265388.1"
FT   misc_feature    complement(13153..14013)
FT                   /old_locus_tag="pVSAL320_19"
FT                   /note="Antirestriction protein [DNA replication,
FT                   recombination, and repair]; Region: COG4227"
FT                   /locus_tag="VSAL_p320_19"
FT                   /db_xref="CDD:33952"
FT   misc_feature    complement(13636..13986)
FT                   /old_locus_tag="pVSAL320_19"
FT                   /note="Domain of unknown function (DUF1738); Region:
FT                   DUF1738; pfam08401"
FT                   /locus_tag="VSAL_p320_19"
FT                   /db_xref="CDD:149455"
FT   misc_feature    complement(13636..13986)
FT                   /old_locus_tag="pVSAL320_19"
FT                   /note="HMMPfam hit to PF08401, Domain of unknown function
FT                   (DUF1738), score 1.7e-71"
FT                   /locus_tag="VSAL_p320_19"
FT                   /inference="protein motif:HMMPfam:PF08401"
FT   gene            complement(14093..14638)
FT                   /old_locus_tag="pVSAL320_20"
FT                   /db_xref="GeneID:6962640"
FT                   /locus_tag="VSAL_p320_20"
FT   CDS_pept        complement(14093..14638)
FT                   /locus_tag="VSAL_p320_20"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_except="(pos:complement(14636..14638),aa:Met)"
FT                   /old_locus_tag="pVSAL320_20"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="CDS contains a rare Valine start codon (GTA)"
FT                   /db_xref="GI:209967963"
FT                   /db_xref="GeneID:6962640"
FT                   /translation="MVISYSVVICYICFLAITCFYCRFNAQLSCLYFLFRAFFSVEKGS
FT                   FPRVARPPITFIRKETEFLTASRFLSLFPPTQNNIKSQCQSKINGFHFCFFVLVIVDSG
FT                   FIASLFFLWVTFHIVSQLPVNRFSPQPIGQGYINASRPCPIERWQEIEQSGDDEDENSL
FT                   NHRKNSHDLLNSYQLNNH"
FT                   /protein_id="YP_002265389.1"
FT   misc_feature    complement(14300..14629)
FT                   /old_locus_tag="pVSAL320_20"
FT                   /locus_tag="VSAL_p320_20"
FT   gene            complement(15125..15391)
FT                   /old_locus_tag="pVSAL320_21"
FT                   /db_xref="GeneID:6962641"
FT                   /locus_tag="VSAL_p320_21"
FT   CDS_pept        complement(15125..15391)
FT                   /locus_tag="VSAL_p320_21"
FT                   /gene_family="HOG000073312" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_21"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967964"
FT                   /db_xref="GeneID:6962641"
FT                   /translation="MKFSRVKEGEFKRLVDTKTITTLIAQESNNEHNKFSLFGIDEKNQ
FT                   LGYAVRHGRIYELRTWRLDILSALVKSLGFTSIEVYFSKVGKK"
FT                   /protein_id="YP_002265390.1"
FT   gene            15528..16211
FT                   /old_locus_tag="pVSAL320_22"
FT                   /db_xref="GeneID:6962642"
FT                   /locus_tag="VSAL_p320_22"
FT   CDS_pept        15528..16211
FT                   /locus_tag="VSAL_p320_22"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_22"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967965"
FT                   /db_xref="GeneID:6962642"
FT                   /translation="MEFSIDFYKHYISVYEKNITKFEHILTDSDLTDRLYYEKTYYDIL
FT                   SKLYISENDDMYDSAQNFISEMNKDIPDDKCKDFPYLLGLLNGYYKIFLIKIKSEEKDI
FT                   YINEAIEFLHGYAIELNDLYDELATCKEDFDVIPYSLNVKIHDEMDILYQSINPITDNL
FT                   KSYFLSSRHGGARLNAGRKKEEPTRQMRIPKSLYTLINDLKIAYKDLTDKDKEIFRSSL
FT                   EDIFK"
FT                   /protein_id="YP_002265391.1"
FT   gene            complement(16310..16576)
FT                   /old_locus_tag="pVSAL320_23"
FT                   /db_xref="GeneID:6962643"
FT                   /locus_tag="VSAL_p320_23"
FT   CDS_pept        complement(16310..16576)
FT                   /locus_tag="VSAL_p320_23"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_23"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967966"
FT                   /db_xref="GeneID:6962643"
FT                   /translation="MKYISFILLIFLFGCSIQKNEEMWFSSNGKVATDNEMLQCFKKCS
FT                   FDNVLFKRLANADINGDFNEAYAQLLDAVQCIEHSGYEKRVPK"
FT                   /protein_id="YP_002265392.1"
FT   sig_peptide     complement(16520..16576)
FT                   /old_locus_tag="pVSAL320_23"
FT                   /locus_tag="VSAL_p320_23"
FT   misc_feature    complement(16532..16564)
FT                   /old_locus_tag="pVSAL320_23"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="VSAL_p320_23"
FT                   /inference="protein motif:ProSite:PS00013"
FT   repeat_region   16723..20024
FT                   /note="VSa19"
FT   repeat_region   16723..16747
FT                   /note="IR of VSa19"
FT   gene            16858..19917
FT                   /old_locus_tag="pVSAL320_24"
FT                   /db_xref="GeneID:6962644"
FT                   /locus_tag="VSAL_p320_24"
FT   CDS_pept        16858..19917
FT                   /locus_tag="VSAL_p320_24"
FT                   /gene_family="HOG000076378" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to sequence:UniProt:Q06238"
FT                   /old_locus_tag="pVSAL320_24"
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="Weakly similar to Enterococcus faecium Transposase
FT                   for transposon Tn1546 UniProt:Q06238 (988 aa) fasta scores:
FT                   E()=5.5e-41, 25.488% id in 1024 aa"
FT                   /db_xref="GI:209967967"
FT                   /db_xref="GeneID:6962644"
FT                   /translation="MTKLAIFTPKEQRDFDTPPKFYKIDRSRYFSISSEIKRSGFNKLR
FT                   TDINRVGFILQLGYFRASGKFYVKEDFRKRDIKYVCNMLEITEKIDINLYSDTSRKYHR
FT                   DNILSLSGWKLPDESHDEKLNYHAKWFIEQQLSPRKVIKALVEYCWSNKLIIPTYSKLS
FT                   AYITVHFNDYEEQLLVIIKKQMTKEQNESLQTLFNSIDKTRPLSRPPITSLKTINQSVK
FT                   PTEIQKNVETFEMVKSYHLSVKTLTHHLQLTDQATEYFATWVKKAQTFQLTSFSSTHKA
FT                   YLHMLAYLKHQFYLRQDTLIDIYLKSTLSTKSQLTAKLQQIEKEQQSGRNTAIKVVSKS
FT                   NKNLTKFRNRVIDIVTQSPLSDTEVVRQLENLIEESLRSYDKKEQDNIREMESFLAALT
FT                   GNGRYFDIVESLSLKLQRRVSNILKIVEFSDRSTNKELLSAINHFSLSDGDVGHNPPLE
FT                   FLNQAERDAVVREGKFRVSLYKALLFFHVADDIKAGQLIFDATYKYKGIFDYLIDEETW
FT                   AKDRDKLLQAAGLWEFSNVSTVLDGLRKKLNIKYHDVNIRLVEGKNPYFQLDSDNRPKV
FT                   KTPKIDNNDFGFVGDTLMQNGYVPIQKILADVNQVCDFKSCFTHFSNKHKKMKPSLNVL
FT                   LAGLLGKGCNLGLNRIANISVGISEDVLNNTVKWFFDLKNIQAASDSIVSYIDKLSLAN
FT                   AYRHDANQLHTSSDGQKYYVSVDSLNSTYSFKYFGSEKGSTVYTFIDERQALFYSTVIS
FT                   ASEREAAYVLDGITHNDVVKSDIHSTDTHGYTESIFGAAHFMGTSFAPRIKGLGSQTIY
FT                   DFDGKSLHSEKGHTIRPSRAIRKKLIKDNWEDILRFMVTIKLKKASASRLFSRLNSYTK
FT                   QMPLYNALKEFGRIMKSNFLLTYYDDMELRQRIEKQLNRVELSNKLAKAIFFANNQEIQ
FT                   EGEKDEQDLTAACKMLIQNSIVLWNYLYLSQYLANLNGVEERTNAAQSILNGSVLTWRH
FT                   INLHGQYDFTRDSANDDEFDLERILALLIV"
FT                   /protein_id="YP_002265393.1"
FT   misc_feature    16873..19845
FT                   /old_locus_tag="pVSAL320_24"
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /locus_tag="VSAL_p320_24"
FT                   /db_xref="CDD:110523"
FT   misc_feature    18973..19770
FT                   /old_locus_tag="pVSAL320_24"
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /locus_tag="VSAL_p320_24"
FT                   /db_xref="CDD:34263"
FT   misc_feature    16858..19845
FT                   /old_locus_tag="pVSAL320_24"
FT                   /note="HMMPfam hit to PF01526, Transposase, score 4.4e-17"
FT                   /locus_tag="VSAL_p320_24"
FT                   /inference="protein motif:HMMPfam:PF01526"
FT   repeat_region   20010..20024
FT                   /note="IR of VSa19"
FT   misc_feature    20025..20828
FT                   /note="Similar to C-terminal part of Erwinia carotovora
FT                   MobA protein UniProt:Q47385 (498 aa) fasta scores:
FT                   E()=1.1e-13, 35.211% id in 284 aa. CDS is truncated by the
FT                   insertion of the downstream and upstream IS elements and
FT                   subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:Q47385"
FT   repeat_region   complement(20829..22388)
FT                   /note="VSa9"
FT   gene            complement(21116..22195)
FT                   /old_locus_tag="pVSAL320_26"
FT                   /db_xref="GeneID:6962652"
FT                   /locus_tag="VSAL_p320_26"
FT   CDS_pept        complement(21116..22195)
FT                   /locus_tag="VSAL_p320_26"
FT                   /gene_family="HOG000266100" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to sequence:UniProt:Q5EJX2"
FT                   /old_locus_tag="pVSAL320_26"
FT                   /codon_start="1"
FT                   /product="putative transposase"
FT                   /transl_table="11"
FT                   /note="Identical to Aliivibrio salmonicida Plasmid pVS43
FT                   Putative transposase UniProt:Q5EJX2 (359 aa) fasta scores:
FT                   E()=2.3e-156, 99.721% id in 359 aa"
FT                   /db_xref="GI:209967968"
FT                   /db_xref="GeneID:6962652"
FT                   /translation="MLSCGTAAFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATE
FT                   RWIQKQQHVFPECEYQHITFTLPNTLWPIFRHNRWLLNKLFKCAANILLGWAKDKGIDV
FT                   GIFCALHTYGRKLNWNTHLHLSVTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGK
FT                   AYYELDLSSEECPYIRNKTDWSRFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPP
FT                   ISASRLSHYAKGGMITFNYLDHRTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFL
FT                   SMRRRGEALPRVYAALGMTIEAEPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVG
FT                   NSVNDLVTHAIVQSELRAA"
FT                   /protein_id="YP_002265394.1"
FT   misc_feature    complement(21338..21883)
FT                   /old_locus_tag="pVSAL320_26"
FT                   /note="Putative transposase; Region: Transposase_32;
FT                   pfam04986"
FT                   /locus_tag="VSAL_p320_26"
FT                   /db_xref="CDD:147256"
FT   misc_feature    complement(21326..21883)
FT                   /old_locus_tag="pVSAL320_26"
FT                   /note="HMMPfam hit to PF04986, Putative transposase, score
FT                   6.2e-49"
FT                   /locus_tag="VSAL_p320_26"
FT                   /inference="protein motif:HMMPfam:PF04986"
FT   gene            22851..23915
FT                   /old_locus_tag="pVSAL320_27"
FT                   /db_xref="GeneID:6962646"
FT                   /locus_tag="VSAL_p320_27"
FT   CDS_pept        22851..23915
FT                   /locus_tag="VSAL_p320_27"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_27"
FT                   /codon_start="1"
FT                   /product="iron ion ABC transporter, periplasmic component"
FT                   /transl_table="11"
FT                   /note="Experimentally shown to be regulated by iron.
FT                   Predicted Fur boxes indicate direct Fur regulation"
FT                   /db_xref="GI:209967969"
FT                   /db_xref="GeneID:6962646"
FT                   /translation="MKKLNYIIFYSALFTAGFSHADVTFEDSRGKLITLDKYPQKIVAI
FT                   ASSAPIIYSAVSQKPETIISMTAKSKKTIINGLYSDFFPYLKSVSADAAKDKFVPNVEA
FT                   ILKYNPDLIFQWGYDPKLSEPLERVGLTVATWPCCSDLDRQSTVLMSGYISGNIERAKM
FT                   IINSANQASDTLKSTLSSINKNNYPTMLEIDQLDQNIRIIANNSRDYSISGVDNLGHDD
FT                   NAEWWKTINVEQLYIWNPEMIIIPAWAEQLTPNAFYTNPLLADLHAVKNRNVYKVPLFH
FT                   RSPDASEAYLTMQWLAHISYPELFTNSSFIDKVRHAYKTIYGVDISENQYIRIMQTEQN
FT                   KVSHDYEKKFGLKG"
FT                   /protein_id="YP_002265395.1"
FT   sig_peptide     22851..22913
FT                   /old_locus_tag="pVSAL320_27"
FT                   /locus_tag="VSAL_p320_27"
FT   misc_feature    22893..23765
FT                   /old_locus_tag="pVSAL320_27"
FT                   /note="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component [Inorganic ion transport and
FT                   metabolism]; Region: FepB; COG0614"
FT                   /locus_tag="VSAL_p320_27"
FT                   /db_xref="CDD:30959"
FT   misc_feature    <23094..23768
FT                   /old_locus_tag="pVSAL320_27"
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /locus_tag="VSAL_p320_27"
FT                   /db_xref="CDD:174075"
FT   misc_feature    order(23217..23222,23232..23234,23307..23309)
FT                   /old_locus_tag="pVSAL320_27"
FT                   /note="intersubunit interface; other site"
FT                   /locus_tag="VSAL_p320_27"
FT                   /db_xref="CDD:29734"
FT   misc_feature    22965..23687
FT                   /old_locus_tag="pVSAL320_27"
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 7e-05"
FT                   /locus_tag="VSAL_p320_27"
FT                   /inference="protein motif:HMMPfam:PF01497"
FT   gene            23912..24955
FT                   /old_locus_tag="pVSAL320_28"
FT                   /db_xref="GeneID:6962647"
FT                   /locus_tag="VSAL_p320_28"
FT   CDS_pept        23912..24955
FT                   /locus_tag="VSAL_p320_28"
FT                   /gene_family="HOG000045407" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to sequence:UniProt:Q288C8"
FT                   /old_locus_tag="pVSAL320_28"
FT                   /codon_start="1"
FT                   /product="iron ion transport system, inner membrane
FT                   component"
FT                   /transl_table="11"
FT                   /note="Similar to Gluconacetobacter diazotrophicus ABC-type
FT                   Fe3+ transport system permease component FeuB
FT                   UniProt:Q288C8 (342 aa) fasta scores: E()=1.8e-30, 37.771%
FT                   id in 323 aa"
FT                   /db_xref="GI:209967970"
FT                   /db_xref="GeneID:6962647"
FT                   /translation="MNNIVYYRPSRDKCILGLIGILVMLTFYSATLGRYDITFDKVIMI
FT                   LLDNVISSSDITWSTIESRVVELIRMPRILAAILIGIGLSVSGVAAQALFRNPLVDSTI
FT                   IGVTSGAAFGGTLAILLFESTIMTVLLSFIFGMLSVFAVMLLARINGRTSVLTLVLVGV
FT                   IISTFFGAAISIVKLLADPFSKLPSITYWLMGSLSAVSYDSLVILLLTVLPSSIIIYLL
FT                   RYQMNIVSMGEERASALGTPFNKVRWIVLIAMAVISSGVVATAGAIGWVGLIIPHVARF
FT                   LVGANHIRLIPTAALIGGIFMLAIDNAARTMSDAEIPIGIMTSLIGVPLFAFILRRSQS
FT                   NSGWNND"
FT                   /protein_id="YP_002265396.1"
FT   sig_peptide     23912..23998
FT                   /old_locus_tag="pVSAL320_28"
FT                   /locus_tag="VSAL_p320_28"
FT   misc_feature    23924..24925
FT                   /old_locus_tag="pVSAL320_28"
FT                   /note="ABC-type enterobactin transport system, permease
FT                   component [Inorganic ion transport and metabolism]; Region:
FT                   FepG; COG4779"
FT                   /locus_tag="VSAL_p320_28"
FT                   /db_xref="CDD:34391"
FT   misc_feature    24164..24916
FT                   /old_locus_tag="pVSAL320_28"
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /locus_tag="VSAL_p320_28"
FT                   /db_xref="CDD:119348"
FT   misc_feature    order(24185..24187,24197..24205,24569..24574,24578..24586,
FT                   24590..24595,24599..24616,24620..24628,24749..24751,
FT                   24770..24772)
FT                   /old_locus_tag="pVSAL320_28"
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /locus_tag="VSAL_p320_28"
FT                   /db_xref="CDD:119348"
FT   misc_feature    order(24200..24202,24206..24208,24221..24223,24380..24382,
FT                   24386..24391,24398..24403,24410..24415,24422..24424,
FT                   24431..24436,24440..24442,24479..24484,24491..24493,
FT                   24719..24721,24872..24874,24881..24886,24893..24895,
FT                   24902..24907,24914..24916)
FT                   /old_locus_tag="pVSAL320_28"
FT                   /note="dimer interface; other site"
FT                   /locus_tag="VSAL_p320_28"
FT                   /db_xref="CDD:119348"
FT   misc_feature    order(24440..24442,24521..24523,24695..24697,24707..24709,
FT                   24839..24841,24863..24865)
FT                   /old_locus_tag="pVSAL320_28"
FT                   /note="putative PBP binding regions; other site"
FT                   /locus_tag="VSAL_p320_28"
FT                   /db_xref="CDD:119348"
FT   misc_feature    23948..24916
FT                   /old_locus_tag="pVSAL320_28"
FT                   /locus_tag="VSAL_p320_28"
FT   misc_feature    23972..24922
FT                   /old_locus_tag="pVSAL320_28"
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,score
FT                   4.3e-85"
FT                   /locus_tag="VSAL_p320_28"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   gene            24948..25694
FT                   /old_locus_tag="pVSAL320_29"
FT                   /db_xref="GeneID:6962648"
FT                   /locus_tag="VSAL_p320_29"
FT   CDS_pept        24948..25694
FT                   /locus_tag="VSAL_p320_29"
FT                   /old_locus_tag="pVSAL320_29"
FT                   /codon_start="1"
FT                   /product="iron ion ABC transporter ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967971"
FT                   /db_xref="GeneID:6962648"
FT                   /translation="MINIDRVSLCHDSMTILSNYSITIDKGDVVAIMGANGVGKTTLLT
FT                   ALIGSKSISQGAISVDGVIGYVPQLFDMPFSYSVLDIVLMGRARYLGLTKTPNSNDFGL
FT                   ARYYIEMMQITHLSERNFNQLSGGQKQLVMIAQALTSQCDVLILDEPFSSLDYHNQTIV
FT                   LDKIRQLNQELGMTVVYTTHMPQHAIETASHVLLMSGKSEYLYGTTSDTLTSQSLTALY
FT                   GIEVGVAVFQSDQSITLAPRFKRSFL"
FT                   /protein_id="YP_002265397.1"
FT   misc_feature    24948..25631
FT                   /old_locus_tag="pVSAL320_29"
FT                   /note="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components [Inorganic ion transport and
FT                   metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
FT                   /locus_tag="VSAL_p320_29"
FT                   /db_xref="CDD:31317"
FT   misc_feature    24957..25550
FT                   /old_locus_tag="pVSAL320_29"
FT                   /note="ABC component of the metal-type transporters.  This
FT                   family includes transporters involved in the uptake of
FT                   various metallic cations such as iron, manganese, and zinc.
FT                   The ATPases of this group of transporters are very similar
FT                   to members of iron...; Region: ABC_Metallic_Cations;
FT                   cd03235"
FT                   /locus_tag="VSAL_p320_29"
FT                   /db_xref="CDD:72994"
FT   misc_feature    25026..25550
FT                   /old_locus_tag="pVSAL320_29"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.8e-42"
FT                   /locus_tag="VSAL_p320_29"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    25047..25070
FT                   /old_locus_tag="pVSAL320_29"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /locus_tag="VSAL_p320_29"
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    25320..25364
FT                   /old_locus_tag="pVSAL320_29"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /locus_tag="VSAL_p320_29"
FT                   /inference="protein motif:ProSite:PS00211"
FT   gene            25691..26980
FT                   /old_locus_tag="pVSAL320_30"
FT                   /db_xref="GeneID:6962649"
FT                   /locus_tag="VSAL_p320_30"
FT   CDS_pept        25691..26980
FT                   /locus_tag="VSAL_p320_30"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_30"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967972"
FT                   /db_xref="GeneID:6962649"
FT                   /translation="MKKIGYITWGCGSQVLSFRDYSHWIDDLIYVHELPKINLNQYAAV
FT                   IIACHTNGEFIAQHAEQINQYVRDGGFLIAFPVRGIDQWLDVVDVKWEDKRIEDWLWWT
FT                   KSDGYIELYQPTRDHSLFDFVNIEDMKWHWHGVFACGHTGLSLLNTENAHDSLIVDFPN
FT                   LPNNGRVLLTTLDPHSHNGQRFMPAATRFVTGFYPWLNCELSIDREVIPDFNVTYLSSS
FT                   DIPTENEPPYLAATFDNTPGNINFKSIYELQDHIWLSDVLIVPRICDQFYLRTLQDKFM
FT                   NYLAKGGQLIINTETVIEWLPVLKAFKTISPNPFVNLKVRVNNDPYGFFSNMPEDFYTW
FT                   EGVFGQYSRGYSEPPENAVYLTHVGCGEDPKPSDWMWQYPTDDGRGGKVVVHNGDDYHR
FT                   YPDHGIHKNTLLRDICLGLIKNRNRTIVNV"
FT                   /protein_id="YP_002265398.1"
FT   gene            complement(27160..28497)
FT                   /old_locus_tag="pVSAL320_31"
FT                   /db_xref="GeneID:6962650"
FT                   /locus_tag="VSAL_p320_31"
FT   CDS_pept        complement(27160..28497)
FT                   /locus_tag="VSAL_p320_31"
FT                   /gene_family="HOG000228816" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pVSAL320_31"
FT                   /codon_start="1"
FT                   /product="putative phage intergrase"
FT                   /transl_table="11"
FT                   /db_xref="GI:209967973"
FT                   /db_xref="GeneID:6962650"
FT                   /translation="MLFAMNQKELNRVDVIRDVCEKRLTQENASNTLNLTRRQVQRLVN
FT                   KYRENGASGLASLQRGKPSNRRFSPAFKRNTLSILKDKYVDFGPTFANEKLLEQHGIKL
FT                   SSETLRHWMIDEGLWKSRAKPKPKTYQPRYRRESLGELIQIDGSHHDWFEGRADKCCLL
FT                   VFIDDATGRLMTLRFSEVESTYDYMNATREYIEQHGKPIAFYSDKHSVFRINKKAPLSG
FT                   NQMTQYGRALYELNIDLICANSSQAKGRVERANKTLQDRLIKEMRLAGIDSMEQANAWL
FT                   PIFIADFNHRFGRAPHSLEEAHRPLRESSEELDDIFARQKTRKVSNALTLQYDKVVYLI
FT                   EPTDATARLAGKNVMIYDYPDGTLSIKHCGKALPYHVFDKLRQVNQGAVVDNKRLGAAL
FT                   SFAKRSQEERSDTLERTRSAQTFSRTAQKRARQINPILRESLKPDK"
FT                   /protein_id="YP_002265399.1"
FT   misc_feature    complement(27712..28080)
FT                   /old_locus_tag="pVSAL320_31"
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /locus_tag="VSAL_p320_31"
FT                   /db_xref="CDD:154329"
FT   misc_feature    complement(27595..28095)
FT                   /old_locus_tag="pVSAL320_31"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain,score
FT                   1.2e-19"
FT                   /locus_tag="VSAL_p320_31"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   misc_feature    complement(28363..28428)
FT                   /old_locus_tag="pVSAL320_31"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1434.000, SD 4.07 at aa 24-45, sequence
FT                   LTQENASNTLNLTRRQVQRLVN"
FT                   /locus_tag="VSAL_p320_31"
FT   repeat_region   28930..30764
FT                   /note="VSa9"
FT   misc_feature    29123..30598
FT                   /note="Similar to Aliivibrio salmonicida Putative
FT                   transposase UniProt:Q5EJX2 (359 aa) fasta scores:
FT                   E()=1.2e-167, 99.7% id in 359 aa. CDS is disrupted by a 399
FT                   bp insertion"
FT                   /db_xref="PSEUDO:CAQ81963.1"
FT                   /inference="similar to sequence:UniProt:Q5EJX2"
SQ   Sequence 30807 BP; 9740 A; 5802 C; 5684 G; 9580 T; 1 other;
     ACTGCCATAT GACAATGAAG TTATGACTAG TTCTAGCTAC TATTTGAATT AAAAGGTGAT        60
     CACGAGCTAA AAGAAAGGCT ACTAGCTTAG GTCTGGCCTT TTCAATGCAT AGTTCAAGTG       120
     TTGCGACTAA TTATCCTTAC GTCCATCAAG CGGATTAATA TATTGATATT CTTTTCTACA       180
     GGAAAACTCT CCCTCTTGCC GCTTTGGTAC TAATCGGTTC CACTCGGATA ATTTATCTAA       240
     TGACGTATAT CCATAAATTT CATACTTTTT AATTATGTAC GCTTGGCATA TTCTTTTATA       300
     CCAACACGAA CCATATTTTT TTTCAGTCAT GTTCATTACA CCAATACAGT GACACTCTTT       360
     TTACATATAA AACTGAGTCT AAGGCCTCTC TTTATCAAAT AGACAATGCC TAACTACTAC       420
     AATGAAGCTC TTGTGATAAT GACCTCTTCA TCAAACAAAT TATGAGCAGT AGTAGTCATC       480
     GAATTAGGAA TACTAACGGT GATTAACTTA TTTGCATGAA ACGCATTATT ACCAATATTA       540
     ATCAATGAGT TAGGTATTGT TATGTTCGTT AGCTGATTAT TGAAGAATGC TTTATTACCA       600
     ATCGTTGTCA CCGAATTTGG GATTATTACA TGAGTTAATT TATTATAAAA AAATGCAGAG       660
     TCATCAATAG TAATCACTGA GTTTGGGATA TCTACACTTG TTAATTTGTT ATTAGCAAAT       720
     GTTCTATTAC CAATGGTTGT TACTAAGTCA GGAACTTTCA CTCTTGTTAA TTGATTATAA       780
     GAAAACACCG AATTACCTAT GGTTATCACT GAATCAGGGA TCGTCACGCT GGTTAACTCA       840
     TTTTGAGTGA ATGCCGAATC ATGAATAATT TTCACCGAGT TAGGAATGAT TACTTTTTTT       900
     AGATGGTGAA AAGAAAATGC GGAATCACCA ATAGAGGTCA CAGATATATG TTGAAATTGT       960
     TCAGGAATAA TAATATCGGT ATAACTCGAA ACATAACCTA AAATCGTACC TGTATTTTTA      1020
     TCAAACTTAA CGTCATCTAA TGTTAATTCA ATTGAGGCGT TAGCAACGCA GGTGGTTAGT      1080
     ATCGATATGA CAAATAAAGT TAATTTTGTT AAAGGCTGAT TTTTTTTCAT ATATGATCTT      1140
     AAAATTAAAT AACGTCTAAA TCCATGATAG TAGACCGGAC AACATGGTTA GGTTAATAAC      1200
     CTAATCACGA AATAGACAGC CTAGCCGATT TCCCACCTTA TAACGTCAGC ATAAAAACAA      1260
     AATTATTTAT CCATAGCCTG TACCTATAAC ATTAGGGTAC ACCCTAATGT CATAGGTTTA      1320
     ATTTTAGCCC TAAAATCATT TTGTCATCAT CTTTTTGTCA TGTAGTATTA GATCATTACT      1380
     TTAATGACAC CTAGGCTCAA TTCATGTACA TATTTGGCTA TCTAAGAGCA TCAACCAAAG      1440
     AACAAGACGC AAAAAGAGCA CAAGACAGCT TAAAGTCTTT TGCTGAAGAT AAAGGTGCTC      1500
     GTATTGCTGG TTGGTATATT GAAAACGTTT CTGGCGCATC ACTACAAAGA CCTGAATTAA      1560
     TGCGATTACT TAAAGATGCA GAAAAAGGCG ACGCTATCCT TATTGAGCAA GTTGATCGCC      1620
     TTTCTCGTCT TAATGATGAA GATTGGGAAA CACTAAAAGC ATTAATCAAT AAAAAACAAT      1680
     TAAAAGTGAT CAGCTTGGAT TTACCAACCA GCCACACAGT ACTAATGAAA CATCATAATG      1740
     ATGATTTTAC ATCAGCCATG TTCAGAGCAA TCAATAATAT GATGTTAGAC ATGCTGGCGG      1800
     CCATAGCACG AAAAGATTAT CAGGATAGAC GAAGGCGTCA GGAGCAAGGT ATTGAAAGAG      1860
     CCAAGGTGGA AGGTTTTTAC AGAGGCCGAA GACCTGATTT AGATATGCAT GAAAAAATAA      1920
     TCCAACTTCG TGTTCATAAT CAGCTAAGTG TCAATGCAAC AGCGAAGTTG GTAGGGGTAA      1980
     CAGCAAGAAC CGTGATACGA ATAGTTAAAA TATACAATGA AGATCGAGTT TAGATATTCA      2040
     AACTCATATC GTTATTTAGA TTTTACGTTC TTTTCCCAAT CCACATCAAA CACATTTTCA      2100
     GTCCCTTGAG ACACTAAATG CATGGGAGGA ACATTCCAAC TATTTCCTGA ATCATCTAAA      2160
     ACAGAGATCG TTTTTTGATT TTTCTTAATC ACAATACCGC ATACTTTAGA ACCATTAGGA      2220
     GGTATAAAAA AAACGGGATC TCCTAACCTA AAATTGTCCA TAAGTACTGA GTTTTTGAGC      2280
     GATTCTAACT CTCTTAATCG CTCTGTAATT CTGTCATTTA ATTCAATCAA TTCTTTTATT      2340
     GTCAAATCAC TTATATCAAA CATAAGGATT TCCACATAAT GTATGCAACT TTGGTTTCTT      2400
     TGTGATTAAG TCAGAATATT TTAACCAACA CTGAACGAAT AAAGAGACCG ATTTATCTTC      2460
     ATTTTTAACA CCGAGTAAAA ACAACTTTTC TTCGTCACTG TCTGGCATTA GAGAGCCATC      2520
     AAGAAGCCCT TTCATGGTCA AACCATAATT ATCTAAAACT GCGGCTTCCT TAATCGTAAA      2580
     TCCTTTGCGA TTAAACCCTT TTGGAAAATG GACATCATCG TAAAACCGAA TGCTTTTTCT      2640
     CATATTTTTT GCCATCAAAT AAATAGACTT GACCATATAA AGCAATTTTT ATTTTTTGTA      2700
     AAACAAAATT AATTTTCATT TATAAAAACA GCTATAACAA CGCATTTCAC TCACTAATTT      2760
     CGCTCTGATT TAGTGGCATA GCCATACTCT CTAGCAAATC GCTTCACTTC ATTGATAGGA      2820
     CGATACTGTT TAAACTCTTT ATCAAAAGAG ATTGAAAATA ATCGAATGTA CTCTTCATAA      2880
     GATGTACCAC TCTCTTTACT AGCAAGATCT GCTATATCTG CAATCTTGTG CATCACTGAA      2940
     TGGGATAACA TTGATACTCT CCTTTTTAAA ACCATTAAGC AAAGGCATAG CCTTTTCTAT      3000
     ATGACCGCAA GAATCCTGCG TGTTTCAGAT CCATTAACAC AAAATTAATG GTATCACGCC      3060
     CTACCCCTTT AAATCTCTCA CCAATTCCTC GTTGACTTGG TTTTACTTCT TTTGCTAATA      3120
     CCGCTTGCTT GATCTCCAGA TAGACTTGCT CATTACATTT TAGATGGTCG TCACTGAATA      3180
     CTTCCTCTTC ATGACAATCA ACAGGCTCAG AAACGCAGTC ATTAAAATAT TCGTCATTCA      3240
     CTGCGCACGA CTGCGGTTCA ATTTCTAACT GCGTTTGGAT AAAGTCAGGC TGAATAAGCT      3300
     CTAGCGCAGA CGATTTATCA TGACTGCGCA CAACTGCGTT CGAGTGCGTG TGGCTGCGTT      3360
     TCAATGCGTT AGAAACCAAC ACTAACAACC AGCTCATTAA TTCGAGTGCC GCTGACGTAA      3420
     TGTAACTAAT CAACAAACCG AATTTATCAA AGACCGTCAA TTCGCTAGGT AGAGTCGATT      3480
     GGCGTTGATA AAGATCATCG ATACGAACTA AAAGAGGTTC AATTTTTTCT AGCGTTCTTT      3540
     CCGATTTAGT AATGAGGTTT GCGTTTTGTT GTTTGGCCGC AAGAAGACGT AACTCGTCCA      3600
     CTTGGGTTGT GTATTCTTTA ATTTGCTGAG AAACGGCTTG ATAAGCAGTA CTGTTTTTTT      3660
     GACTAGCGAC AACGCCTTGC TCTAAAGCGG CCACCGATGC AGAGAACGAA ACAACACTTA      3720
     ACGTCATACT CAATACCAGA GCAAACAGCG CAGAAGCGTA TTGTTTTTGT GAAAACAAAA      3780
     ATAGAACAAA CAACGGTGTA GCGCATTTAG CCAAATCTAA CACAATGCCT AACGCTGTCA      3840
     TTAGTATAAG CTCACCCATA GCTAACCCTA TGCCATACAT GAATTGAGCC GTTAAAATTG      3900
     CAGATAGAGA AGCCGTTGCG ATAGATAGCA CTATGCAAAT AGGCTTTAAA ATAGTAGAGT      3960
     TCATTTGTGA TTAATTCCTA TTGAAATAGT TGGTCACGCT AACCCCTAGG AGACTTTGGC      4020
     GAGGAACTTA GGGGTTTTTC ATTCTTTCAT TCTTTCATTC TTTCATTCTT TCATTCTTTC      4080
     ATTCTCGTAA AATGATAAGA ATAACTCTTT CAAAGACAAG CCTCTTTCTG CTGCATATGA      4140
     TTTAATTTCA TTATGTTTTT CTGGTGTCAC TTTAAACTGA ATATTTTTAG TTTCTTCACC      4200
     ACTAGATGCT TTACTACTTG CTGGCATATC TGTTACTAAT GTAGGCTTAC CTGATGGTGG      4260
     TGCTATTTTT ACTTTATTAT TTTTCATAAA AACCTCGATC ATTAAATCAT TAAATCATTA      4320
     AATCATTAAA TCATTAAATC ATTAAATCAA CAATTTCTTG AATTGCTTTT GATGTCAATT      4380
     TATTAAGTGA TGGATATCTA GTCTCGGTAA TAGACAAACC TTGATCTTGA GCAGAGGAAT      4440
     ATCCTGCTTT AAAAGGAATC GCTGTTTGAC ATACGTTGAA CCCCCACGCC TTAATTGTTT      4500
     CAACCGCATT ATTTGTTTCA GAATCAGTAG GCGACTTATT GATTAAAAAA ATGATTTTAT      4560
     CAACAGGTAT ACCATTCATT TTCAAATCAT TCGCTAAATG TAATTGAGGC TCTAAATCAT      4620
     CTAATGAAGT ACCCGTTGGT AACACAATTA GTGATGATGC TTTCGCTATA ACAATAGAAT      4680
     CCCGATCAGC GGCAGGGCGG CCATCTATAA CAAGTAAATT ATATGATTTC TCACATTTTA      4740
     ATGCAGACTC AACTCGGCGA TGAGCTGATG TTGTAATTGT TGGTTGGATT TCTTTTTGAT      4800
     CTCTTCTAGC AGACCATTTA CAAGATGTTT GCTGCTGCCA ATCCATATCG GCAATATGTA      4860
     CAGTCCAGCT ATTATCAGCA AAAGCAACTG CAATACTTCT AGCTAAAGTA CTTTTAGTTA      4920
     CTCCTCCTTT TTGACTTAAA AAACTAATTA TCATAATAGT ACCAATCATT ATTTAATGAA      4980
     AACATGAAAT AATGATTAAA TGTTTTCATT ACTCCATGAA AGAATGAAAA CATTATAGCA      5040
     CAGGAATCCA CCAATTAAAT CATTAAAACA TGCTTTAATT AATTCATGAA ATCATGTTTT      5100
     AATGATTTGC ATTTAAGTCT TTGTTATAGC GGATAATTAA TTTACAACCA TTAATTTTTT      5160
     TGACATTATA TTTATAGAAA GAGGGCGCTA TGTCAGTGTT TAAAATTAAC TACCTGAATA      5220
     ATGAAAAGAC GTTACTGTGC AGCGAAACGA TTTTAATGAA AGGACTTCCA GCCGCAAAAC      5280
     GTTCATCATC GTCAATGGGA ACGGTGAAGA TTGAAATTTA CGATATAGCC GAAAACTTAC      5340
     TCACATCAAA AGAATTGGGG AAGTGGACAG TTGCAGAATA AAAGCCTTAT CAGGCTTTTA      5400
     TTTTTCAGGA GTAGGGATTT TATGCAGCAA TACGGTCGCA CATCGATTAT CAATTGACGT      5460
     CGATAAATGC TCTGCAATAA ACATCCCTCC ATGACCATTA ATAATATCCA CCAATCGGCT      5520
     TGGCTCATCC ATGATGACAG AAAGAGGTAG CGGTCTGAAT AAGATATTTT CATCACTAAA      5580
     GCAGGTATCA ATTAATTCAC TGTCGGTATA AATAATACCA GGCTCTCGTT CAATCTCTGA      5640
     GTTGTCGAGC GTCGATTCAA AGCCATGCTG TTCATAAAGA TAAGTCAGTA AGATAAACAG      5700
     ATGGTCTGCA TCCGTAAATT TCTCGCCATA TTGACAGTTC ACTTTGTGTA ACTCCCCTAA      5760
     TTTTTTCTCG ATGTTTTTGC CTTGACGCGC CTGAGTAATT AACACCTTAA TGTCTTTCTT      5820
     TATGATGGCG TTACCCTGTA ACGCCATTTG TTTCTTTAGA AACTTAATCA GTAGCTCGCT      5880
     CCGCTTCTTC ATCGGTACAA AACGCGATGA CATTTCCATG TAGCTGTACA GATGAAGCAG      5940
     AGCAAGAGTG GTTAAATTGG TAAAGGCTTG ATGGTATTTA AGTTTGCTCA TGGTGCTCAC      6000
     TAAAAAAAGA GTAGGCTATT GCAGAGAAGG TAATCCTAAT GCCAATCGCC ATAAAGCATC      6060
     CATTTTATCA GGAAAGGGAA GCGGTTGACC ATTTTGATGT ATTTGGGGAG AGTTTGGATA      6120
     TCGGACATTA TTGTACGGTA GTGATACTGA TGTGATCTAT CCCGTTTGGG TGTACCTCAA      6180
     TGAGATAGGG AATTGCAGCA GTAATAACAT CAATGCGCTA ACTTAAATGC GATAGCCTTT      6240
     GTACGACAAC TTAAAAACGA TAGTCAATTG AAGTAATCAA TGGGTTAGCG GTACGAACTG      6300
     AACAAATTTT GCTCTTAACG TACAATAATT TTCGATATCC AAACTGCCCC CTAATAGACA      6360
     GGCGTATTGG AATACATACT GTTAAATTCA CGACGACAAC GCTCACACAT AAAGCCATTC      6420
     CTCAGCATCA TTAAACATTT CTTCAATCAG CTTATTGGCT GCTTCTTTGT CATTTTTAGG      6480
     AGCATAGATT TCTAAATGAT TGCTTGTACC TTTTCGTAAT CGGATACGTG CATCAGGGTA      6540
     ACGTTGCCAT ACTCGACGCT CCATTTCTTG TTGAATAAGC GCGGTTCCAT TTCTTGGTAG      6600
     AAAAGCGGAA TTTAAAATCA TTTCAATACG CATAATAACC TCACAATTAA CTGTATATAT      6660
     AACCAGTACA TTTTTATACA GTATGCAAGA AAAGTAAATC ATTATTTATT CTTTTAAATT      6720
     CGTATAGATA ACAATAGGTT AATCATCTTA TCGTTGTTTT CTGCTCTATT GGTGCTCAAC      6780
     CCCCTTAATG GGATGTATTT CATTTTAAGC AGGTTTTTAA CCTGTTTGAA ATACAAAGCG      6840
     ATACAGGAAA AGAGAGCGGT AACGGTCATG GCTCGATGAT ACCGTTGTTT AGTAAGTCAG      6900
     AGTCATTCAC TTCCACAATA CCTTATAGAA ACCAATATAC GAGCAAATAT CCCTACATTT      6960
     AAAGTAACCT CAGCCCCTTT TCTGCAAGAA TGCTCTTAAA GTTCGGAGTA TAACCAGGAT      7020
     GTATTGTGTT TCCTGTCGGA TGACAAAAGA AATCTTCAGC GCAGCCAGTA GGGTGATGGT      7080
     CTATTCATGT GTAATGAAAT TGAACTGGCT GGGGGCCTGT TAATTTTCTT CTGAAATCTT      7140
     TTTGTGTTTG AAGAGTAAAT TGAAAATTAA TGGGAGGTAC TTAATGTTCT GCTCTTTGTT      7200
     TTTCTTAAAT ATTTATTTAA TTATTTATAT AAATACAAAG TACTAATACG TTAGTACTCA      7260
     TAAGCGCAGC CGTGTATTCG TAGCCTTTAT TGTGCTTTTT TTTAAGGATA ATTTATTGCA      7320
     CTACCTTTAT TGTGGATAAC AAAATTAATC CACAGCCACA CGAAAGTAAG CCAAAAACAA      7380
     CGATAATTAT TGTAGTTAAT CAGATAAACA GGTAAAAATA GGGGTAAAAA TCAGGCTCTA      7440
     TGAATTTTAG ATGTGAGAAT GCCTCCGCTT TCGCGGATAC GTTTAATCAT AGTTAATGAG      7500
     GGGCAGGATG TGGCAAGTAA GCATCAAAGA CAGCAGTAAC ACTTTGAGCT ACATTATTGA      7560
     GCTTATCCGC GTTAAATACT TCTTGTACGC CATTGGCAAG GGTTCGGAAC GATACCCAAG      7620
     AGAAACGTAA GCCTTTTTTC TCTTGACGCT TACGAGACGC AATAATGAGT TGGCAAATAT      7680
     TGCTGTAACG AACCACTTTC AAGTCACTAA AGAAACGCTC AGAGAACTGT TTATACGCAG      7740
     GGGCACTACG AATAGTCCCT TCTTTCAGAT CGACACAAAC GTTGATACGC TCACTGTGAA      7800
     GATAACCAGC GCGCTTCAAG TATGAGATCG CTTTAGCGAA CGATTTAGGC GAAATAAAAC      7860
     GACCAAAGCG CAACGCATAA TCTTCTTGTA AGTGATCATA ACTGATCGTT TTTAGCCCAG      7920
     CTTCCGTTGG TAAACCAATG CGGCCACCAA TGAGATCAGT ATTTACAATG ATACATGCAA      7980
     GTACGTTAGC AACGAGTCGT CGGCATTGAA TATTATTAAC GCCTTCACCT CCCCACGCAT      8040
     TTAATGCAGG GAAACGGTTC GGGTTAGCTA TAAATTCTTC ACACGATTTT AAAATACGTG      8100
     CGTATTCAGG CGGCAAGATT TCCCATTTGC CACTGCGCAG CAAACGACGA GAGCGAAAAT      8160
     CGAATTTAAA AGGGGTCTTA GGCTTCTTTT TGTTTTCATC AGCAACAACA GAACGATGAA      8220
     GTTCAATCAG CTCATGCTTA CGATTTTTAC GTTTAGAACG ATATTCAGCA TCATATTGTT      8280
     TTTTGATTTG AATTTTAGAG AGAAGATCAG AAATGCTCAT GAGACACATC CTCATCATAA      8340
     CGTCTGATAG CATAAGCTAA GGCATTACGG TGATAGGAAT TGCGTCTTTG TGTTATGGGT      8400
     TGCCAGAGGC AACATTGAAA TAAGTTCATC TTTAGATTCT CAACAGTTTA TAGGGCTGTT      8460
     TAAGTGTCAC CTCAAACATT GATAACTAAT CTATAGGAAA AGATCACAAA GATCAACCGA      8520
     TTGTTATTTC AACAAATTTT AAGTATAAAA AAAGCCGACC CTGTTGAGGT AGTCGGCTTT      8580
     TTTACGAATG CTGTATAGTT AGATTGACAG TCTAACACAC TCTAGCTTAA AAAATACACT      8640
     ACATAAGAAA CTATGTAGTA GTGTGCTATG TAATGCACTT TAAATTAAGT TAGGCCTATT      8700
     ATATCCATAA TATGTATTAT TATAAAGTAC ATTTTAGTCA ATTTCAGTTA AGTTTCGTTG      8760
     AATGCCAAAT AACTTGTCCA ATAATATTTA AATCATCCAA TTCAGAAAAT TTATACATTT      8820
     CATCTTTATA TTCTTTATTG TAGCTCGTAA CTATCAAATG GTTTTTCTCA TATGAGATCA      8880
     ATTTCACTCG AAGTAAATCA TCTTGTCTAA ATACATACAT ATGACCATCA ATAATATTTT      8940
     TACTTTGAGT GTCAACTACA AGAATGGAAC CATCTTTAAG CACAGGCTCC ATTGAATCAC      9000
     CGCTAGCGGT TAGTGATACT AGATGTTCAA TATTTGACAC CTGTAAATTT TCAATATCTA      9060
     CATACGTATA AGTTTCAGAA TCATTAATAA TACCTAAACC AGCAGCGACT GATACATTAT      9120
     AAAATGGAAC CGATACTACA CGGGGACAAC GATCATCTAT TTCGCCTCCC CCTTTCAAAT      9180
     ATTCATAAGT CGTATCAAAA AACGTAACTA TCGATAATAA ATTTTTATTC TTTGGTTGCG      9240
     CTTTTCCAAC TTCCCATTGA GAAATGGTAG ATTTTGTAAC ATTTATTTTC TCAGCTAAAG      9300
     ATTCTTGCGA AAGTCCTTGA TTTAATCTTA ACGACTTAAT TCTTTCGCCA ATTGTTGTCA      9360
     TTTCTAACTC CCGAATCTAA AGAAAATAGC TAATTTTTTA ATTATTAGCT ATTTTTTGTC      9420
     GATTTTTGTC GATTCTTGTC TATTTTAAAC TTTACAATGT TCAATTGTTT AATTATCATC      9480
     CTTACTAATG ATCATCCATA CAGTACTTTT TACAGGCTGA AACCCTCAAG GTTATTGAAT      9540
     GAGCAAAAAC AAAAAGCAAG GAGCTATCGG TCTTTGGTTT GAACTCGATA AAGAGACAAA      9600
     TCACTTACTA AAACTTCAAG CTGAAAGAAA TGGACGCAGT AAGCGCGCAG AAGCCCTTGC      9660
     TATCGTCAAA AAAGACATTC AACAAAAACT AACTAATATC CGTTAGTTTT CTTTTTTGAA      9720
     TGAAGATCCA CTTTTTGGAT CTATCGCTCT TTAACAATTA ATGCCAAGGC AGATCATCTA      9780
     CCAGACTATT CGCGTGTGAA CGTCAAGACT CTATTTTTGC TGATCAACGA CAAATGCCCA      9840
     TAATAATTTG TCAGTGTCCA AAGGACATAT CACCCCCTAA TTTTGGCTGG GTAATCAATG      9900
     TATCCGATTG ATTGTAATGT GAGTGGATTT TCTTTTTTCA AAGGAATTAA TGTGAAAGCA      9960
     TTTAGAAAAA ACAGAGTAGA TAAAGCGATC CAGTTAGCTG AGCATCCCAC TTGCTGCGTA     10020
     CTGCATTGGT ACTGTGATAC CAATGGCAAT GTAGTTAAGA GATTTACACA AATTAAACCT     10080
     TATCAAACCT TAATCAGAAA GGACGTGTAT GAAAATGACA CCCACCGAAA TACGCGAAGC     10140
     CGTTTTTATC ATATCCCTCA TGCGAGAAGG CCATAAACCA CGCCCCGAAC GGATTGATGG     10200
     CGAAGCAAAA AAACGCATTG ATGACTCAAC GATGCACATA GCATCACAAG CTCACTCAGC     10260
     GATAAATACT TGGTTTTAGT GCGTGACAAC CACTAAAGAA AACCCGTCTG TTAATGGTCA     10320
     AACCATTCGT GAAGCCAACA CGTAACACTG CATACTCAAA CTAGGGAATA AGTCTTGTAA     10380
     CACTCAGGTG TGTCTATTGG CAGTAGGCAG AAAAACAGCA AGCATCCCTA CTATGTATAT     10440
     ACAGTATCCA AGTATTTATC GCTGAGTGAG TTTCTTCTCT TATCAAATAA GGTAATAACA     10500
     CCATTCAATA CGCCTTGTTC TTAGTCGGTG AAAAAGAGCA GCACAGACCA TTACTGGATA     10560
     TGGCTGAACT TCACGCCCTT AACGCGACAC TTTCAGACAT CACCGAAAGT GATAAAGATG     10620
     AATCTCAATT TGTGCAAAAA CTGGTTTATG GTCGCTATAA ACCTCAACCA GATTTTCATT     10680
     TTCCACGCAG TGAAGTAAAG CGTCATATCA ATAGTGCGAT TGGTTTTTGT TTAGCCCATA     10740
     TATCAAATAC TCACGTCACT TATTTAAATC TTGATGATAT TGAATTAATC GACGTAAACT     10800
     TAACCGCCAG TTGTGGGCAT TGCCCAACAC CACACAAAAC CAATGACATT CCTTTCGCTA     10860
     CCTTAATTTC TTGTTCTTCT GACTTTGAAC TTAATAAGCG AGGGGCAGCA AAAACTGTGT     10920
     TTTTACGTTG TCATAATGTG GATGTACAAA CTGACTTACT TAATCGTATG GGACTGTTTG     10980
     CCTTTATCTG TGAAGAGCGT AATTATTCGT CGCCAGTCAC AAAGGACAAT TGGACATCAC     11040
     GTATTGATTA CCGACGTGCC ACCAAAAGGG CACAAGAATT AAGATAAGGA TTAGTTTATG     11100
     AAACACTGCG TTTTACTTCC AGTAATGGCG TTTCTTTCAT TTTCCGTACA CGCTGAGCTT     11160
     GTGAATGTGT CGTATGATTT CTCAAACGAG CAACAATACC AATCCACCGT ATTGTTGCCA     11220
     ACCTCTGAGT CGTGGGAATT ATCGACTGTT GTCGATAAAC AGGTCATTAC TCAATGGGAA     11280
     AAAGGGCTTG ATAGTGAGTT TAAGCCTGTT TATCACATTG TATCGGAAGG CGTGAATATC     11340
     ACGGCCAAGC CCATTAATAA TGAACAATAG GCGCCTACGG CGCAAATCAA AAGGACTCAA     11400
     CCTCTTCCAT TGTTGCCAAT AAATCGTTTA TCCTATCGCC ATGCACGCAT ATAAACCCCT     11460
     GAAACAATTA TTTAATAGTC AAAATAACTG GCTTAAATTT CTTCATAATA ACAAAGCTAA     11520
     CCTAAGAGCG GTCGTGATTG AAAATGTCAC AAAGATGCTG TCCTGTGGGA CAGCGGCTTT     11580
     TGGCTCTCGC GAATATCATT GTTGCAACCC TGACTGTACC CATATCAAAT ATATTCACCA     11640
     AACCTGTAAA TCTCGAGCGT GCAGTAGCTG TGGCATGAAA GCCACAGAGC GATGGATACA     11700
     AAAGCAACAA CATGTCTTCC CTGAATGCGA ATATCAACAC ATCACCTTTA CCCTTCCAAA     11760
     CACGCTATGG CCTATCTTTC GTCATAACCG TTGGCTGTTA AATAAATTAT TCAAATGTGC     11820
     TGCAAACATT CTGCTGGGAT GGGCAAAAGA TAAAGGAATA GATGTCGGTA TCTTTTGTGC     11880
     TCTTCATACT TACGGTCGAA AACTGAATTG GAATACGCAC TTACATTTAT CGGTCACTCG     11940
     TGGGGGAATT TGTGAACGTA CCGGTTTATG GAAACCCATT TACTTCCAAA TGAAAACGAC     12000
     AGAGCCTTGT TGGAGAGCGG CTATCGTCAG TTTATTGGGT AAGGCTTATT ATGAGCTTGA     12060
     TTTATCAAGC GAAGAATGCC CCTATATCCG TAATAAAACG GATTGGTCAC GCTTTTTAAG     12120
     CAGTCAATAT AATCGTCGTT GGAAGCTTCA TTTTGCTAAA AAGACAAATA ATGTAAAACC     12180
     GACGATGAAC TATCTTGGTC GGTATTTAAA ACGGCCCCCG ATTTCAGCGT CACGTTTAAG     12240
     TCATTACGCC AAAGGCGGAA TGATAACGTT TAATTATTTA GACCATCGAA CAGGAACAAC     12300
     AGACAGCCTA ACATTATCAC CAGAAGAGAT GATAAGACGG ATAGTAGAGC ACTATCCTGA     12360
     TAAACATTTC AAGATGATCC GATACTACGG TTTTTTATCA ATGCGTCATC GTGGAGAAGC     12420
     TCTGCCTAGA GTTTATGCAG CTTTAGGTAT GACAATAGAA GCTGAGCCGA AAATGCCAGG     12480
     GTATGCCGCA ATGTTAAAAG GATATGTAAA AGTAGATCCG TACGAATGTA TTTTATGTGA     12540
     AAGTCGTCTG GTGTTTACGA ATTTCCGAGT CGGAAATTCG GTCAATGATT TAGTCACCCA     12600
     TGCGATAGTT CAGTCAGAAT TGAGGGCAGC ATAATAAGGT TTGTAGGATA AGTGTATCTA     12660
     AAACTCATGA AATAGGGCTA AAACAGTTAT AAAATCCCCG ATAATTATAT TTTCGATACC     12720
     TTTTAAAAAA ACAGCGATGG TGAAATTGGC TTTTTTAGAC GGGCCAATGC TAACTCAGCA     12780
     ACATTCAAAT TCCTTACCTT TAAACCTAAG TATAATAAGC TCTAACTGTT CTTTCTGTGA     12840
     CAACATACTC GATCCATCCT TACAAAAATA CTATGCCGTT ATTTACTGTA CAGTTAGTAT     12900
     ATTACATTCG TTAAATTATA TATAGCAAAA AACGTCGCTA TAGCCAAATA CTATAGATAA     12960
     AATTTCAACG CATAATTCGA ACTTATCCAT CATATCCACA TAAGGATAAC TGGAAACCGT     13020
     TAGAATTATT TCCAGCCTAT TGTGGGTATG TGGGTAAGTT CGAGTGAGCC TTTAGGCTCA     13080
     TTGTGGCGAG GCGAAGAATG AGTCTCGCAC GCAAAAAACC AGTCCGAAGA CTGGTTTATC     13140
     AATTTACGAT TTAAGTAGCC ATTGATGCGC TTTACTCGCT TGACTGGCAG CTTTAAAAAT     13200
     GAATTTCTTA TCATTATTTA AACGCTCTAA CCAACTTGCA ATATAACTTT CATGCTGAAC     13260
     ATCCCCTACT ATTCCCAAAT CTGCACAACA AAATTCTGCG CCTAACTCTG CAATTAATTC     13320
     TTCAAACGCA TAATCTTTTG ACCCAAATCC ATTTTTTAAA TCACGGTCTA AACGGGTTTT     13380
     ATGACCTGTT GAATGAACCA ACTCATGCCA TGCCGTCGCA TAATAATCAT AAGAAGAATT     13440
     AAAACGGTCA ACCATTGGCA ATGTAATTTC GTCATGAGCT GGTGAATAAA AAGCACGAAC     13500
     GCCACAATGA TTAATTGTCA TGTTAGTATT TTTAATCGCA TTTTCTACGT GGTTCAACGT     13560
     CACAAACTCG TTTTTCTCTC TACTTTCTTT CACCATCGCC ACTGGTTTTT CGATGTTGTC     13620
     CACTTGATCA ATGTTAAACA CCGTGAAGGT TTTTAACATT GGAATGGTTT CTATTTTTCC     13680
     GTCTTCGTTT TCTTTTTCCC AACTTTTGTA ATACACAATA GTTGTACCTT TTTGTCCTTT     13740
     AATAACGTTT CCGCCTAGCT CGTTGGCTTG CTTGTATGTC AACCAGTAAG GACTTGTAAA     13800
     ACCTTTCTCT ACCGTTTCAC TCCAAAGCAG TAAAATATTT ACCCCTGAAT AATTTGTTTT     13860
     TGTTTTAAAG TTCATCGGTA ACATTGAACA CTCATTAGTT CTATCCCACG GACATGCCCA     13920
     CGGTTTCACT CCATTTTCTA ACGCAGCAAT AATGCGATCA GTTACCATTT GATAAATGTC     13980
     TTTAGAGACT CTAACCACCG CACGTTTTCT ACTTATTTTA CGCTTTTTAC CCATTTCATT     14040
     TTTGCTTGAG TCTGACTGCT CAAACGAGGA TACGTTTGTC GCTTCTGTTT CTTTAGTGAT     14100
     TGTTGAGTTG ATAGCTGTTG AGTAAGTCAT GGCTGTTTTT CCTGTGGTTA AGTGAGTTTT     14160
     CATCTTCGTC GTCGCCTGAC TGTTCGATTT CTTGCCATCG TTCTATTGGA CAAGGGCGCG     14220
     AAGCGTTTAT ATACCCTTGT CCAATAGGTT GTGGTGAGAA ACGATTTACA GGAAGTTGCG     14280
     AGACGATATG AAAAGTCACC CATAGGAAAA ACAATGACGC AATGAAACCG CTATCGACGA     14340
     TTACAAGAAC AAAGAAACAG AAGTGAAAGC CGTTGATTTT GCTTTGGCAC TGGCTTTTGA     14400
     TATTGTTTTG CGTTGGGGGG AATAACGACA GGAACCTACT AGCCGTTAGA AACTCAGTTT     14460
     CTTTACGGAT AAAGGTTATC GGAGGACGAG CAACGCGAGG AAATGACCCT TTTTCGACAG     14520
     AAAAAAACGC CCTAAATAAA AAATATAAAC ACGATAATTG AGCGTTAAAA CGGCAATAAA     14580
     AACAGGTTAT CGCTAGAAAA CATATGTAGC AAATTACGAC ACTATAGGAA ATTACTACAT     14640
     ATTATTTAAT GAGGGATAAC GGTAAATATA AGAAATAAAA CGAGCAAAAA ATGACGGTAT     14700
     ATATGAAAAG CTAGGATTTG CTAAAGCGTT TAAGGTAGAA TGTCTGCGGG TGCTTTTGGC     14760
     TATCAACCGA AAGCATAACG TAAGTTTTGT AGACGGTAGA TAACTAAAAA CCCCGAAAGT     14820
     AAATTTTCAT TCACTAACGA GGCTTTAGAT ATGTACTTCA ACAATACGGA TCTTAGTCTC     14880
     TATTTTAATA AGAGGCAAGT AAAATGCTAA AAAAATCGGC TGTAACGAGT TTGGTAGTCA     14940
     TTTGTATGAC TATTTTAATT GGTCTTTGGA TGGTACGTGA TTCACTGTGT GATTTTTCGT     15000
     ATCAATCAGG TAGTACGATA ATAACGGCAA CACTTGCCTA CGAATCAAGA TAGAAGCTGG     15060
     ACGGGTAGCT GGAAACAGCT ACCCGATTTC AGATTGTAAG GTATAGGCCA CAAGCACCCA     15120
     TGTTTTACTT CTTCCCTACT TTAGAAAAAT AGACTTCTAT TGAAGTAAAG CCTAATGATT     15180
     TTACAAGCGC ACTTAAAATA TCTAACCGCC ACGTTCTTAG CTCATAAATA CGCCCATGAC     15240
     GGACGGCATA ACCAAGTTGA TTCTTTTCAT CAATACCAAA TAGTGAAAAC TTATTGTGTT     15300
     CATTATTCGA CTCTTGAGCA ATAAGAGTGG TTATCGTCTT AGTATCAACC AGACGCTTAA     15360
     ACTCACCTTC TTTGACACGA CTAAATTTCA TTATTTCTTA CCAATTGAAC ATATTCCCAT     15420
     AATGTATTAT ACATATTGAC GATATGTATT TTAGCTTAAA TATGATTTGT GGTGCAAAAT     15480
     TCAAAATTGT AAAGTATAAT CAACTCATAT AAATAAAGGG GTTAATTATG GAATTTTCAA     15540
     TTGATTTTTA TAAGCATTAT ATAAGTGTAT ATGAGAAAAA TATTACCAAG TTTGAACATA     15600
     TTTTAACTGA TAGTGATTTA ACTGATAGGT TGTATTATGA AAAAACTTAT TATGACATAT     15660
     TATCTAAACT ATATATTTCT GAAAATGATG ATATGTATGA TTCTGCTCAG AATTTTATCT     15720
     CAGAAATGAA TAAAGACATA CCAGACGATA AATGTAAGGA CTTTCCATAT CTACTTGGTC     15780
     TGTTGAATGG CTATTACAAA ATTTTCTTGA TTAAAATAAA ATCAGAAGAA AAAGATATTT     15840
     ATATTAATGA AGCCATTGAA TTTTTGCATG GTTACGCTAT TGAACTAAAT GATTTATATG     15900
     ATGAATTAGC AACGTGCAAA GAAGATTTTG ATGTTATTCC GTATTCTTTA AATGTGAAAA     15960
     TTCACGATGA AATGGACATT CTTTATCAAT CAATAAATCC AATTACTGAT AATTTGAAAT     16020
     CTTATTTTCT ATCTTCTCGA CATGGTGGCG CACGCCTAAA CGCAGGAAGA AAGAAAGAAG     16080
     AGCCAACACG TCAAATGAGG ATCCCTAAAT CTTTATACAC TTTGATTAAC GATCTTAAAA     16140
     TTGCCTATAA AGATTTAACT GATAAAGATA AAGAAATTTT TCGTTCTTCA CTTGAAGACA     16200
     TTTTTAAATA GATCAAGCCT CAAATGGGTA ACATTAGGAG CTACCTTAAT GTTACATGAC     16260
     AATGAAGTAA TGAATGATTT TAACGCCTGA GTCACTACTA TGGCTGGACT TATTTAGGTA     16320
     CTCTTTTTTC ATATCCTGAA TGTTCAATAC ATTGAACAGC ATCTAATAAT TGAGCATAAG     16380
     CCTCATTAAA ATCGCCGTTA ATATCAGCAT TGGCCAAGCG TTTAAATAAT ACATTATCAA     16440
     ATGAACACTT TTTAAAACAT TGAAGCATTT CATTATCAGT CGCCACCTTT CCATTACTCG     16500
     AAAACCACAT TTCTTCATTT TTTTGGATCG AGCAACCAAA AAGGAAAATC AACAAAATAA     16560
     AACTAATATA TTTCATTTTC TACCTCAATA ACATTTATCA TAAAACTATA AATGAAAAAC     16620
     GACTGAAAAC AATAAAACGA CACACCGATG ATAGTTAAAT CTGCTTATGA TGACATTAGG     16680
     GTTTACTTAA ATGTCATTAA TGAAAATATA ATGAATACAA ACTTTAACTG TTCAACTAGC     16740
     TTAGCTAGAA CTAGGGATGT AGCGTGATCG TTAGAGCAAA AGGAAGTGAT CACCGTCGAT     16800
     CTATCTCGAT GGTAAGAAAC ATTGAAATTC CTTACCATTA AAAATAAGAA TCCCGTTATG     16860
     ACCAAACTTG CTATTTTTAC GCCAAAAGAA CAACGTGACT TTGATACACC ACCTAAATTT     16920
     TATAAAATTG ATCGTTCGCG TTATTTTTCG ATATCGAGCG AAATAAAACG ATCAGGTTTT     16980
     AACAAACTTA GGACAGATAT AAATCGAGTA GGGTTTATAC TTCAACTTGG CTACTTTAGA     17040
     GCATCAGGGA AGTTTTACGT CAAAGAGGAC TTCCGAAAAC GTGATATTAA ATATGTTTGT     17100
     AACATGCTAG AAATAACTGA AAAAATTGAT ATTAACCTTT ACAGTGATAC TTCACGTAAA     17160
     TATCATCGGG ATAATATATT GTCACTATCA GGTTGGAAAT TACCCGATGA ATCTCATGAT     17220
     GAAAAATTAA ATTATCATGC AAAGTGGTTT ATCGAGCAAC AGCTTTCTCC TCGAAAGGTT     17280
     ATTAAGGCCC TCGTTGAATA CTGTTGGAGC AATAAGCTAA TTATCCCTAC TTACAGTAAA     17340
     CTTTCCGCTT ATATTACCGT TCACTTCAAC GATTATGAAG AACAATTACT TGTCATTATA     17400
     AAAAAGCAAA TGACTAAAGA ACAAAATGAA TCACTCCAAA CATTATTTAA TTCAATAGAC     17460
     AAAACTCGTC CTCTTTCTCG CCCACCCATT ACAAGTTTAA AGACAATTAA CCAGTCAGTT     17520
     AAGCCAACAG AGATCCAGAA AAATGTTGAA ACTTTTGAAA TGGTAAAGAG CTATCATTTG     17580
     AGCGTTAAAA CATTAACGCA CCACTTGCAA TTAACAGATC AAGCAACGGA ATACTTCGCT     17640
     ACCTGGGTGA AAAAAGCACA AACCTTTCAG TTGACCAGTT TTTCTAGCAC TCACAAAGCT     17700
     TATCTGCATA TGTTGGCCTA TTTAAAACAT CAGTTTTATT TACGGCAAGA TACCCTCATT     17760
     GATATCTATC TAAAATCAAC ATTGTCTACC AAGTCACAAT TAACTGCAAA ATTGCAACAA     17820
     ATTGAAAAAG AACAGCAATC AGGCAGAAAC ACAGCCATAA AAGTTGTTTC AAAATCAAAC     17880
     AAGAATTTAA CCAAATTCAG AAATCGAGTG ATTGATATTG TTACGCAATC CCCACTTTCT     17940
     GACACCGAAG TTGTTCGGCA ATTGGAAAAT CTTATAGAAG AAAGTTTGAG ATCCTATGAT     18000
     AAAAAAGAAC AAGATAATAT TCGTGAAATG GAGTCGTTTC TTGCCGCTTT GACAGGGAAT     18060
     GGCCGATATT TTGATATTGT AGAGTCGTTA TCATTAAAGT TACAGCGTAG GGTGTCAAAT     18120
     ATACTAAAAA TAGTAGAGTT TTCAGATCGA AGTACTAACA AAGAATTACT CTCTGCAATT     18180
     AATCACTTCA GCTTATCCGA TGGTGATGTT GGGCACAATC CACCGCTAGA ATTTTTAAAT     18240
     CAAGCAGAGC GTGATGCAGT TGTTAGAGAA GGCAAATTTA GAGTTTCGTT ATACAAAGCA     18300
     CTGCTATTTT TTCATGTTGC AGATGACATT AAAGCAGGTC AACTTATTTT CGATGCTACT     18360
     TATAAATACA AAGGAATATT TGATTACCTT ATTGATGAAG AAACCTGGGC AAAGGATCGA     18420
     GACAAGTTAC TTCAAGCGGC AGGGCTTTGG GAGTTTAGTA ACGTTTCAAC GGTGTTGGAT     18480
     GGATTACGAA AAAAACTCAA TATTAAGTAC CATGATGTAA ATATCCGGTT GGTCGAAGGT     18540
     AAAAACCCAT ACTTTCAACT TGATAGTGAC AACAGACCTA AAGTAAAAAC ACCTAAAATT     18600
     GATAACAATG ATTTTGGTTT TGTGGGCGAC ACACTTATGC AGAATGGCTA TGTACCAATC     18660
     CAAAAAATTC TGGCTGATGT TAACCAAGTA TGTGATTTTA AATCCTGCTT CACACACTTT     18720
     TCCAATAAGC ACAAAAAAAT GAAACCCTCG TTGAATGTAC TGTTAGCCGG CCTCCTTGGT     18780
     AAAGGGTGTA ACCTGGGATT AAATCGGATC GCAAATATTT CGGTGGGTAT TAGTGAAGAT     18840
     GTCCTGAATA ACACGGTTAA GTGGTTCTTT GATCTCAAAA ACATTCAGGC GGCCAGTGAC     18900
     AGTATTGTTA GCTACATAGA TAAACTATCT CTTGCTAACG CATACAGACA TGATGCAAAT     18960
     CAGTTGCATA CAAGCAGTGA TGGACAGAAA TACTACGTGT CTGTTGATTC GTTAAATTCC     19020
     ACCTATTCTT TTAAATATTT TGGCAGTGAA AAAGGCTCTA CAGTCTATAC CTTTATAGAT     19080
     GAACGTCAGG CACTTTTTTA CTCAACGGTA ATAAGCGCAT CTGAACGAGA AGCCGCATAT     19140
     GTGCTCGATG GCATCACTCA TAATGATGTT GTGAAGAGTG ATATCCATAG TACTGATACG     19200
     CATGGATATA CCGAGTCAAT ATTTGGTGCT GCACATTTTA TGGGGACATC GTTTGCGCCG     19260
     AGAATTAAAG GGCTAGGAAG CCAAACCATT TATGATTTTG ATGGTAAGAG TTTACACTCA     19320
     GAAAAAGGGC ATACAATAAG GCCTAGTCGG GCAATCAGGA AAAAATTAAT CAAAGATAAT     19380
     TGGGAGGATA TTTTACGTTT TATGGTGACG ATAAAACTCA AAAAAGCGTC TGCCTCACGG     19440
     TTATTCTCTA GGCTTAACTC TTATACCAAA CAAATGCCTC TCTATAATGC ACTTAAAGAG     19500
     TTTGGCCGCA TCATGAAATC TAATTTTTTA TTGACGTATT ATGATGATAT GGAATTGCGT     19560
     CAGCGGATAG AAAAACAACT TAATCGCGTT GAATTATCCA ACAAGCTTGC CAAAGCAATA     19620
     TTTTTTGCGA ATAACCAGGA GATACAAGAA GGGGAGAAAG ACGAACAAGA TCTCACGGCA     19680
     GCTTGCAAGA TGCTCATTCA AAACTCAATT GTGCTATGGA ACTATCTATA TCTATCGCAA     19740
     TATTTGGCAA ATTTAAATGG TGTGGAAGAG CGTACTAATG CCGCTCAATC CATCCTCAAC     19800
     GGTTCGGTTT TAACTTGGCG TCATATCAAC CTTCACGGCC AATACGACTT TACCAGAGAT     19860
     TCCGCAAATG ATGATGAATT TGATTTAGAG CGGATACTGG CTTTACTGAT AGTTTGATAG     19920
     TTTCGGTAAA CCCTAGAATA AAGCCATATA TTAATTACTT ATATATCAAT ATGATACCAT     19980
     GGGTAAGTGG GCGTTTTTTA CCGCTTTTGT AGTACAACCC TAAAATTAAG AATAGGGATG     20040
     ATATTAAAAA TATTTTAAAG GAACAGGGTT TCGATATAGC AAGAGAAACC CCAAAAAGCA     20100
     TCTCAATTTC GGATCCCGAA GGTGGGCGAA ATATCAGATT AAAGGGACAT ATTTATGAGC     20160
     AAGATTTCCG ATTTAGCGAA AAACTTCGAG GAGAAATCAC AGCAGCAAGC GATCGATACG     20220
     AAGCAGACAT TAAAGAACGA GTTCAACAAG CACGAAGCGT TTATAGAAAA GGAGTTGAGA     20280
     TTAAGCGAAC TGAAAATGAA AGACGTTATC CACGCACAGA ATCGGCGTCT AAAATGCTTA     20340
     ATATTAAAGA CATGGTTTTG GATGCCAGTC ATGTTAATCA ACCTTCTTTT GGTGAGTTGG     20400
     GGCGTGCTTT ATTATCAAGG GAACCAAATA AAAAAGAATT TGGAGATCAT CAGAAAACAG     20460
     AACCAAAAGA TGAAAGAATT AGAAAAATAC AACGTCAAAG TGATCACGTC AGACGGAGTA     20520
     AACTACCTAG TGCTACCGAA AGGGGCGATA ATTCAAGACA CATATCAGAC GGAAATGGAC     20580
     AAGTATGTAA TCAAGTGGAA ATAAATTATG ACCGAATTAG AAAAGCAGCT TTTGAACGCA     20640
     TTCGAGATTT TACAGGAACA GCACGAGAAG CAACATCAAG ACTTTCAGAG CGCGTACAAA     20700
     AGATTGGAAG AAATGTTTTC CATTACCTCG AAGGAAAACA AGATGCTCAA CGAGCAAGTA     20760
     AATCACTTGA GCGATCAAGT GTCGAACTTG AGCAAGCAAT TAGTAAGACG GAAGTAGAAC     20820
     CTCAGCAGAA GGTAAAATTG AAAGTGAGAG GCGGTTTTGA GCGTTAGCTA CGTGGCTGTA     20880
     ATTATTTTTT GAGGATGTTA GTTAGCTAGA TTTCACGTAG TGAACGTTAA ATAAAATATT     20940
     TAACACTCGA AGGTAAGGAA TTTGAATGTT GCTGAGTTAG CATTGGCCCG TCTAAAAAAG     21000
     CCAATTTCAC CATCGCTGTT TTTTTAAAAG GTATCGAAAA TATAATTATC GGGGATTTTA     21060
     TAACTGTTTT AGCCCTATTT CATGAGTTTT AGATACACTT ATCCTACAAA CCTTATTATG     21120
     CTGCCCTCAA TTCTGACTGA ACTATCGCAT GGGTGACTAA ATCATTGACC GAATTTCCGA     21180
     CTCGGAAATT CGTAAACACC AGACGACTTT CACATAAAAT ACATTCGTAC GGATCTACTT     21240
     TTACATATCC TTTTAACATT GCGGCATACC CTGGCATTTT CGGCTCAGCT TCTATTGTCA     21300
     TACCTAAAGC TGCATAAACT CTAGGCAGAG CTTCTCCACG ACGACGCATT GATAAAAAAC     21360
     CGTAGTATCG GATCATCTTG AAATGTTTAT CAGGATAGTG CTCTACTATC CGTCTTATCA     21420
     TCTCTTCTGG TGATAATGTT AGGCTGTCTG TTGTTCCTGT TCGATGGTCT AAATAATTAA     21480
     ACGTTATCAT TCCGCCTTTG GCGTAATGAC TTAAACGTGA CGCTGAAATT GGGGGCCGTT     21540
     TTAAATACCG ACCAAGATAG TTCATCGTCG GTTTTACATT ATTTGTCTTT TTAGCAAAAT     21600
     GAAGCTTCCA ACGACGATTA TATTGACTGC TTAAAAAGCG TGACCAATCC GTTTTATTAC     21660
     GGATATAGGG GCATTCTTCG CTTGATAAAT CAAGCTCATA ATAAGCCTTA CCCAATAAAC     21720
     TGACGATAGC CGCTCTCCAA CAAGGCTCTG TCGTTTTCAT TTGGAAGTAA ATGGGTTTCC     21780
     ATAAACCGGT ACGTTCACAA ATTCCCCCAC GAGTGACCGA TAAATGTAAG TGCGTATTCC     21840
     AATTCAGTTT TCGACCGTAA GTATGAAGAG CACAAAAGAT ACCGACATCT ATTCCTTTAT     21900
     CTTTTGCCCA TCCCAGCAGA ATGTTTGCAG CACATTTGAA TAATTTATTT AACAGCCAAC     21960
     GGTTATGACG AAAGATAGGC CATAGCGTGT TTGGAAGGGT AAAGGTGATG TGTTGATATT     22020
     CGCATTCAGG GAAGACATGT TGTTGCTTTT GTATCCATCG CTCTGTGGCT TTCATGCCAC     22080
     AGCTACTGCA CGCTCGAGAT TTACAGGTTT GGTGAATATA TTTGATATGG GTACAGTCAG     22140
     GGTTGCAACA ATGATATTCG CGAGAGCCAA AAGCCGCTGT CCCACAGGAC AGCATCTTTG     22200
     TGACATTTTC AATCACGACC GCTCTTAGGT TAGCTTTGTT ATTATGAAGA AATTTAAGCC     22260
     AGTTATTTTG ACTATTAAAT AATTGTTTCA GGGGTTTATA TGCGTGCATG GCGATAGGAT     22320
     AAACGATTTA TTGGCAACAA TGGAAGAGGT TGAGTCCTTT TGATTTGCGC CGTAGGCGCC     22380
     TATTGTTCTT TTTACACAAT AAATATTACC TAGTAATATT TATTGTGTTT TATCTTACAT     22440
     AACATGCGTT ATGCGCAGTC ATTTTTGCTT CTTATGTTGT TTACTTAACC GTGATGATTG     22500
     TAGTATTACA AACTTTTAGA TGACATGAGA AATACTAAAT AACATAAGGC CTGTTTAATT     22560
     TATTAACTTA TTTTTTCGAA ATTGGTAATG TTCAGTGATG GTTTTTATGA TTTTAAGCAA     22620
     TGCGCAACCA GTTTCCACTA GTAAGTTTAG CGTAACGCTA GATTTGAGTT CGATTTTTAA     22680
     CTTTATTTTA GATTCTGAAT TTTTTGGTAT ATAGAAAAAT CCGATATATC ATTACATACA     22740
     CTCGTTGGCC TACCTTTAAA GGGGGGGGGG GGTTGATTTT ATTGAAATGA GATTCATTAT     22800
     TATTACCATT TGAATTATAG TGTGGTTTCA CATAATATTG GAATACAATA ATGAAAAAAC     22860
     TAAATTATAT TATTTTTTAT AGTGCCCTCT TTACTGCTGG CTTCTCACAT GCAGATGTTA     22920
     CTTTTGAAGA TAGTCGCGGA AAGTTGATTA CCTTAGATAA GTATCCACAG AAGATTGTTG     22980
     CGATCGCAAG CTCTGCCCCG ATTATTTACA GTGCGGTTAG CCAAAAACCT GAAACCATCA     23040
     TCAGTATGAC TGCAAAGTCA AAAAAGACTA TCATTAACGG GCTTTATTCT GACTTTTTTC     23100
     CATACTTGAA ATCCGTATCA GCGGATGCCG CTAAAGATAA GTTCGTGCCT AATGTTGAAG     23160
     CTATTTTAAA GTATAACCCA GATCTTATTT TCCAATGGGG GTACGACCCT AAGTTAAGTG     23220
     AGCCGCTAGA ACGTGTAGGT TTAACTGTTG CGACGTGGCC ATGCTGTAGT GATTTAGACC     23280
     GTCAAAGTAC TGTTTTGATG TCAGGTTATA TTTCCGGTAA TATTGAGCGT GCTAAAATGA     23340
     TTATTAATTC CGCTAATCAA GCCAGCGATA CGTTAAAATC CACATTATCT TCAATTAATA     23400
     AAAACAACTA TCCCACTATG TTGGAAATTG ACCAACTAGA TCAAAACATT CGTATTATTG     23460
     CCAATAATTC ACGAGATTAC TCCATTAGTG GTGTTGATAA TTTGGGCCAC GATGACAATG     23520
     CTGAGTGGTG GAAAACAATC AATGTAGAGC AGCTTTATAT ATGGAATCCA GAGATGATTA     23580
     TCATCCCAGC ATGGGCTGAG CAGCTTACTC CGAATGCTTT CTACACAAAT CCTTTATTAG     23640
     CTGATCTGCA TGCAGTAAAA AATCGCAACG TTTACAAAGT ACCATTATTT CATCGTTCTC     23700
     CTGATGCTTC AGAAGCTTAT TTAACTATGC AATGGCTTGC TCATATATCT TACCCAGAGC     23760
     TGTTCACCAA TAGCTCATTT ATAGATAAGG TTCGTCATGC CTACAAGACC ATTTATGGTG     23820
     TTGATATTAG CGAAAATCAG TACATTCGCA TAATGCAGAC TGAACAAAAC AAAGTTAGCC     23880
     ATGATTATGA GAAAAAATTT GGTCTTAAAG GATGAATAAT ATCGTATATT ACCGACCTTC     23940
     ACGTGATAAA TGTATTCTAG GATTAATCGG TATATTAGTT ATGCTGACGT TCTATTCTGC     24000
     CACTTTAGGG CGTTATGATA TCACTTTTGA TAAAGTGATA ATGATTCTAC TTGATAATGT     24060
     TATTTCAAGT TCGGATATCA CTTGGTCTAC TATTGAGTCG CGTGTTGTCG AATTGATTCG     24120
     TATGCCGCGC ATTTTGGCTG CGATTCTTAT CGGAATAGGT TTATCAGTTT CAGGTGTAGC     24180
     CGCTCAAGCT TTATTTAGAA ACCCTCTAGT TGATTCCACT ATCATTGGCG TCACATCTGG     24240
     TGCCGCCTTT GGTGGGACGC TAGCTATATT GTTGTTTGAA AGCACCATAA TGACTGTGTT     24300
     GCTCTCTTTT ATATTTGGCA TGCTTAGTGT ATTTGCTGTG ATGCTATTAG CTCGTATTAA     24360
     TGGCCGTACA TCAGTGCTCA CTCTTGTTTT AGTTGGCGTT ATTATCTCTA CTTTTTTTGG     24420
     AGCTGCTATT TCAATTGTTA AACTGTTGGC TGACCCTTTT TCGAAACTAC CTTCGATAAC     24480
     TTACTGGTTA ATGGGTAGTC TTTCTGCTGT CAGCTATGAT TCGTTAGTTA TATTGTTGCT     24540
     AACTGTATTG CCATCGTCAA TTATAATTTA TTTATTACGT TATCAAATGA ATATCGTATC     24600
     GATGGGAGAA GAACGAGCAA GTGCGCTCGG TACACCATTT AATAAAGTTC GCTGGATTGT     24660
     GCTGATTGCC ATGGCGGTAA TTTCATCAGG AGTTGTAGCA ACAGCTGGCG CAATTGGTTG     24720
     GGTAGGATTA ATCATTCCCC ATGTCGCTCG TTTTTTGGTC GGCGCAAATC ACATTCGCCT     24780
     CATTCCTACT GCAGCTCTTA TTGGTGGTAT TTTTATGCTC GCTATCGATA ATGCTGCGCG     24840
     TACGATGTCA GATGCAGAAA TTCCAATTGG TATTATGACT TCACTTATTG GTGTACCGCT     24900
     GTTTGCATTT ATATTGCGTA GATCACAATC AAATAGTGGG TGGAACAATG ATTAATATCG     24960
     ACAGAGTTAG TCTTTGTCAT GACTCTATGA CAATTTTGAG TAACTATAGC ATCACTATCG     25020
     ATAAAGGTGA TGTGGTGGCC ATTATGGGGG CTAATGGTGT CGGTAAAACG ACATTGTTAA     25080
     CCGCACTGAT AGGCAGTAAA TCTATTAGCC AAGGTGCTAT TTCGGTCGAT GGTGTTATTG     25140
     GCTATGTGCC ACAGCTTTTT GATATGCCAT TTAGCTACAG CGTACTTGAT ATTGTACTTA     25200
     TGGGGCGTGC TCGTTACCTC GGTTTGACAA AAACACCTAA TAGCAACGAT TTCGGTCTAG     25260
     CACGTTATTA CATTGAAATG ATGCAAATAA CTCATCTTAG CGAGCGTAAT TTTAACCAAC     25320
     TAAGTGGGGG GCAAAAACAA CTAGTCATGA TTGCTCAAGC TCTCACATCT CAATGTGATG     25380
     TGTTAATTCT AGATGAGCCA TTCTCATCTT TGGACTACCA CAACCAAACA ATTGTGTTAG     25440
     ACAAAATTCG ACAGCTTAAC CAAGAGTTGG GTATGACAGT TGTATATACC ACCCATATGC     25500
     CGCAGCATGC CATCGAAACA GCGTCACACG TATTGTTAAT GAGTGGAAAG TCTGAATATC     25560
     TCTATGGCAC TACTAGCGAT ACGCTAACTT CCCAAAGTTT AACTGCTCTA TACGGCATTG     25620
     AAGTTGGTGT TGCAGTATTT CAATCCGATC AGTCCATCAC ACTAGCACCT AGATTTAAGA     25680
     GATCATTCTT ATGAAGAAAA TTGGTTATAT TACTTGGGGG TGCGGCTCGC AAGTGCTTTC     25740
     TTTTCGTGAT TATTCTCATT GGATAGATGA TCTTATCTAT GTTCACGAAC TGCCAAAGAT     25800
     AAATCTAAAC CAATACGCGG CAGTGATTAT AGCTTGTCAC ACTAATGGAG AATTTATTGC     25860
     TCAGCATGCT GAGCAGATTA ATCAATACGT TCGTGATGGT GGCTTCCTTA TCGCATTTCC     25920
     TGTGCGAGGC ATCGACCAAT GGCTTGATGT TGTAGATGTA AAGTGGGAAG ACAAACGTAT     25980
     AGAAGATTGG CTATGGTGGA CAAAATCTGA TGGCTATATT GAACTTTATC AACCCACGAG     26040
     AGATCATAGT TTATTTGATT TTGTCAATAT TGAAGATATG AAGTGGCACT GGCATGGTGT     26100
     ATTTGCTTGC GGACATACAG GCTTGTCACT ACTCAATACA GAAAATGCTC ACGACTCATT     26160
     GATAGTCGAC TTCCCTAACT TACCAAATAA TGGACGAGTG CTGTTAACCA CACTCGACCC     26220
     ACACAGTCAC AATGGTCAAC GTTTTATGCC TGCAGCAACG CGCTTTGTGA CAGGCTTCTA     26280
     TCCTTGGCTG AACTGTGAGT TAAGTATTGA TCGTGAGGTG ATTCCTGACT TTAATGTTAC     26340
     TTACTTATCA AGTAGCGATA TTCCAACAGA AAATGAACCG CCATACTTGG CGGCTACTTT     26400
     TGACAATACA CCAGGTAATA TTAATTTCAA ATCTATCTAT GAACTGCAAG ATCATATATG     26460
     GTTAAGCGAT GTGCTAATCG TGCCGCGTAT TTGCGATCAG TTCTATCTCC GAACGCTACA     26520
     AGATAAGTTT ATGAATTACT TAGCTAAAGG TGGCCAACTA ATTATCAATA CGGAAACGGT     26580
     CATTGAATGG CTACCAGTGC TTAAGGCATT TAAAACCATA TCACCTAATC CATTTGTAAA     26640
     CCTTAAAGTA AGAGTTAACA ATGATCCTTA TGGATTCTTT TCTAATATGC CGGAAGATTT     26700
     TTACACTTGG GAAGGTGTTT TTGGACAATA CAGTCGTGGT TACTCTGAGC CTCCCGAAAA     26760
     CGCCGTCTAT CTGACTCATG TAGGCTGTGG TGAAGATCCC AAGCCTTCTG ACTGGATGTG     26820
     GCAATATCCA ACAGATGATG GCCGTGGTGG TAAAGTTGTG GTGCACAATG GCGATGACTA     26880
     TCATCGTTAT CCCGATCACG GGATACACAA AAATACATTA TTACGTGATA TATGCCTTGG     26940
     ATTAATTAAA AACCGTAACC GAACAATTGT TAACGTTTAA GAATGGAACT GAATGTTAGA     27000
     TTTAGCCTCC TAATTGGAGG CTTTTTAGAT CTTGGAATAA AATCGTCAAT ATACGGCCTA     27060
     TTGAACATAA AGACGATAAT GCGCAATACC ATTTGTTAAA GCATGTTAAA GCAAGTTAGA     27120
     AATGTCACAT ATTTCACCAA GATAGAAATG TCACATTTGT TATTTATCCG GTTTTAGTGA     27180
     TTCGCGTAAA ATAGGATTGA TTTGTCGTGC TCTTTTTTGT GCTGTTCGGC TGAACGTTTG     27240
     GGCGCTTCTC GTTCGCTCCA ACGTGTCACT TCTTTCTTCC TGACTTCGTT TCGCAAAAGA     27300
     CAGCGCCGCA CCCAATCGCT TGTTATCAAC AACCGCACCT TGATTAACCT GTCGCAGTTT     27360
     ATCGAACACG TGGTAAGGCA AGGCCTTACC ACAATGCTTT ATGCTCAATG TGCCATCCGG     27420
     GTAGTCGTAT ATCATGACGT TCTTACCCGC TAAACGCGCT GTCGCATCCG TAGGCTCTAT     27480
     TAGGTAAACC ACTTTGTCGT ATTGCAATGT TAACGCGTTC GATACCTTAC GGGTCTTTTG     27540
     ACGCGCGAAT ATGTCGTCGA GTTCTTCTGA ACTTTCCCGT AACGGACGGT GTGCTTCCTC     27600
     TAAACTATGC GGCGCTCGAC CAAATCGGTG ATTGAAATCT GCAATGAAAA TAGGCAGCCA     27660
     CGCGTTCGCT TGCTCCATTG AATCAATGCC TGCAAGTCGC ATTTCTTTGA TTAGCCTGTC     27720
     TTGTAGGGTT TTGTTTGCTC TTTCAACTCG CCCCTTAGCT TGAGAGCTGT TAGCACAAAT     27780
     TAAATCGATA TTTAATTCAT ACAAGGCACG ACCGTATTGT GTCATCTGAT TACCACTAAG     27840
     AGGCGCTTTC TTATTGATTC TAAAGACAGA ATGCTTGTCG CTGTAAAAAG CGATGGGCTT     27900
     GCCATGTTGC TCAATATATT CCCGTGTCGC ATTCATGTAA TCATATGTTG ATTCCACTTC     27960
     ACTGAAGCGT AATGTCATTA ATCTACCGGT GGCATCGTCA ATAAATACCA ATAGACAACA     28020
     TTTATCTGCA CGACCTTCGA ACCAGTCATG ATGTGAGCCA TCAATTTGAA TAAGCTCACC     28080
     TAAAGACTCT CGCCTATACC TGGGTTGGTA GGTCTTTGGC TTAGGTTTCG CACGGGACTT     28140
     CCATAAGCCT TCGTCAATCA TCCAGTGCCG TAATGTCTCT GATGACAGCT TGATACCATG     28200
     CTGTTCGAGT AATTTCTCAT TCGCAAATGT AGGCCCGAAA TCAACGTATT TATCTTTGAG     28260
     AATACTCAAC GTATTTCGTT TGAACGCTGG TGAGAAACGT CGATTACTTG GTTTTCCTCT     28320
     TTGCAATGAG GCTAACCCTG ACGCACCGTT TTCACGGTAT TTGTTAACTA ACCGTTGAAC     28380
     CTGTCTTCGC GTTAAATTAA GGGTGTTTGA AGCATTTTCT TGAGTTAATC GCTTCTCACA     28440
     AACGTCACGA ATAACATCAA CACGATTTAA TTCTTTTTGG TTCATAGCAA ACAACATGAC     28500
     ACATAGCTCT GATAGGATTA GTAATGGAAA TAATCCTATC AGAGCTATGT GTCATCTCTA     28560
     AGTTGGGGAA ATGTGACATT ACTATATTGG GTTAACAACC ATTTCATCAC TCGGGATAAA     28620
     TACCCTCTCT AATGCTTATT CCCCCCCTTT AAAATCGATT TAAACCCGCA ATTATGCATG     28680
     GCAAATTTTG CACCATCATT GGGAAAGTAG GTTTCGGTTA AAATCGGGCT GAAAGGCTTA     28740
     TTTACACAGG AATGATTTGC TGGACTGGAG CGTAGGATTC ATTACTTATT GTGAGATCAA     28800
     CTCGATACGA TCAATTTCTA CGGCTTGATC GTTATGCCTA GATCGCATAC TATAAAAACA     28860
     GATGAAAAAA AAACCTCTTC AGCCAGCAAG CTTCAGAGGT TTTAGAACGC CCTAATAGGA     28920
     CGTTTATGCG AACAATAGGC GCCTACGGCG CAAATCAAAA GGACTCAACC TCTTCCATTG     28980
     TTGCCAATAA ATCGTTTATC CTATCGCCAT GCACGCATAT AAACCCCTGA AACAATTATT     29040
     TAATAGTCAA AATAACTGGC TTAAATTTCT TCATAATAAC AAAGCTAACC TAAGAGCGGT     29100
     CGTGATTGAA AATGTCACAA AGATGCTGTC CTGTGGGACA GCGGCTTTTG GCTCTCGCGA     29160
     ATATCATTGT TGCAACCCTG ACTGTACCCA TATCAAATAT ATTCACCAAA CCTGTAAATC     29220
     TCGAGCGTGC AGTAGCTGTG GCATGAAAGC CACAGAGCGA TGGATACAAA AGCAACAACA     29280
     TGTCTTCCCT GAATGCGAAT ATCAACACAT CACCTTTACC CTTCCAAACA CGCTATGGCC     29340
     TATCTTTCGT CATAACCGTT TGTTAAATAA ATTATTCAAA TGTGCTGCAA ACATTCTGCT     29400
     GGGATGGGCA AAAGATAAAG GAATAGATGT CGGTATCTTT TGTGCTCTTC ATACTTACGG     29460
     TCGAAAACTG AATTGGAATA CGCACTTACA TTTATCGGTC ACTCGTGGGG GAATTTGTGA     29520
     ACGTACCGGT TTATGGAAAC CCATTTACTT CCAAATGAAA ACGACAGAGC CTTGTTGGAG     29580
     AGCGGCTATC GTCAGTTTAT TGGGTAAGGC TTATTATGAG CTTGATTTAT CAAGCGAAGA     29640
     ATGCCCCTAT ATCCGTAATA AAACGGATTG GTCACGCTTT TTAAGCAGTC AATATAATCG     29700
     TCGTTGGAAG CTTCATTTTG CTAAAAAGAC AAATAATGTA AAACCGACGA TGAACTATCT     29760
     TGGTCGGTAT TTAAAACGGC CCCCAATTTC AGCGTCACGT TTAAGTCATT ACGCCAAAGG     29820
     CGGAATGATA CGTTTATTTT TTTAACCTCG AACGGAATAA CATGAAGGTT AACGTTGTCC     29880
     CCAGAAGAGA TGATAAGACG GATAGTAGGG GGGAATTTTG AAAGCCCCCG TTTTGGAAAC     29940
     CCCTTTCTTC CAAAGGGAAA CGACAGAGCC TTGTTGGAGN GCGGCTATCT TCAGTTTATT     30000
     GGGTAAGGCT TTTTATGAGC TTGATTTATC AAGCGAAGAA TGCCCCTATA TCCGTAATAA     30060
     AACGGATTGG TCACGCTTTT TAAGCAGTCA ATATAATCGT CGTTGGAAGC TTCATTTTGC     30120
     TAAAAAGACA AATAATGTAA AACCGACGAT GAACTATCTT GGTCGGTATT TAAAACGGCC     30180
     CCCAATTTCA GCGTCACGTT TAAGTCATTA CGCCAAAGGC GGAATGATAA CGTTTAATTA     30240
     TTTAGACCAT CGAACAGGAA CAACAGACAG CCTAACATTA TCACCAGAAG AGATGATAAG     30300
     ACGGATAGTA GAGCACTATC CTGATAAACA TTTCAAGATG ATCCGATACT ACGGTTTTTT     30360
     ATCAATGCGT CGTCGTGGAG AAGCTCTGCC TAGAGTTTAT GCAGCTTTAG GTATGACAAT     30420
     AGAAGCTGAG CCGAAAATGC CAGGGTATGC CGCAATGTTA AAAGGATATG TAAAAGTAGA     30480
     TCCGTACGAA TGTATTTTAT GTGAAAGTCG TCTGGTGTTT ACGAATTTCC GAGTCGGAAA     30540
     TTCGGTCAAT GATTTAGTCA CCCATGCGAT AGTTCAGTCA GAATTGAGGG CAGCATAATA     30600
     AGGTTTGTAG GATAAGTGTA TCTAAAACTC ATGAAATAGG GCTAAAACAG TTATAAAATC     30660
     CCCGATAATT ATATTTTCGA TACCTTTTAA AAAAACAGCG ATGGTGAAAT TGGCTTTTTT     30720
     AGACGGGCCA ATGCTAACTC AGCAACATTC AAATTCCTTA CCTTAAATTT GAGGTGTAAT     30780
     TTACACTATG ACATATGCCT ATCCCTT                                         30807
//

If you have problems or comments...

PBIL Back to PBIL home page