(data stored in ACNUC9435 zone)

EMBL: AM039949.PARA

AM039949.PARA        Location/Qualifiers
FT   CDS_pept        18152..18802
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="XCVb0021"
FT                   /product="Plasmid partitioning-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19768"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19768.1"
FT                   /translation="MKILVLASQKGGAGKTTLAAHLAVAAETAGAGPVVLLDTDPQGSL
FT                   SAWWNSREAQSPALASATLKELPEKLDALAAAGFKLAVIDTPPAIADAIRDVVRLADLV
FT                   LIPTRPSPHDLRAVGSTVDIAQEAGRPFAFAVTQAKPTARITVQAVAALSAHGPVAPAI
FT                   VHDRVDYATSMVDGRTVGEVDARSRSAEEIRTLSAFVNERMHEKKKAKIKETV"
     atgaaaatac tggtgctggc cagtcagaag ggtggagctg gaaaaaccac gttggccgcg        60
     cacttggcgg tggcggccga aaccgccggc gctggcccgg tggtcttatt ggatactgac       120
     ccgcagggtt ctctgtcggc ctggtggaac tctcgcgagg cgcaaagccc agccctcgcc       180
     tcagctaccc tcaaggaact gccggagaag ttagacgcac tggcagctgc cggtttcaaa       240
     ctggccgtca tcgacacacc gccggcgatc gccgatgcca tccgcgacgt ggtgcgcctg       300
     gctgatttgg tactgatccc tacccggcca agcccgcatg atctgcgtgc cgtcggcagc       360
     accgtggaca ttgcccagga ggccggccgg ccgttcgctt tcgccgtgac ccaggccaag       420
     ccaaccgcgc gcatcaccgt gcaagcagtg gcggctctat cagcgcacgg cccggtggcg       480
     ccagcgatcg tgcatgaccg cgtggactac gcgacttcga tggttgatgg ccgcaccgtg       540
     ggtgaagttg acgcccgcag ccgcagtgcc gaagaaatcc gcactttgag tgcattcgtt       600
     aatgaacgaa tgcacgaaaa gaagaaagcc aaaataaagg aaactgtata a                651
//

If you have problems or comments...

PBIL Back to PBIL home page