(data stored in ACNUC9435 zone)

EMBL: AM039949.PE1

AM039949.PE1         Location/Qualifiers
FT   CDS_pept        complement(96..443)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19748"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19748.1"
FT                   /translation="MPETIKLDTARELAVAGSIRDTVLLGQRGGFLIIFRMGMSERVLA
FT                   TKYGVPRLFSGLDAAAKVLREISITRFQVDASDLVKDDSTRRRRPDRAAALKQTYRDAA
FT                   LVLSRHINDAQ"
     atgcctgaga cgatcaagtt ggacactgcc cgggagcttg ccgtcgccgg cagcatccgc        60
     gataccgtgc tgctcgggca acggggcggc ttcttgatca tcttccggat ggggatgtcc       120
     gaacgggtcc tggcgaccaa atacggagtc ccgagactct tcagcggcct cgatgccgct       180
     gccaaggtcc tgcgcgagat ctccatcact cgcttccagg tcgacgccag cgacctggtc       240
     aaagacgaca gtacccgccg gcgcaggcct gaccgtgccg cagcccttaa gcagacctat       300
     cgggatgcag cgctagtgct atcacgccac atcaatgacg cccagtag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page