(data stored in ACNUC9435 zone)

EMBL: AM039949.PE10

AM039949.PE10        Location/Qualifiers
FT   CDS_pept        complement(7606..7947)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19757"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19757.1"
FT                   /translation="MATKAMRAMSNRGLSVLAAWKIYLKLLESRNSSYAQTLISHRKLV
FT                   EAMSLPTRDVTAGIDHLVNHSLVHVRQHDVLGSVGHPVNQYNLLGEFRSKPITVSIGGF
FT                   PISTRVAEM"
     gtggccacga aagcgatgcg tgcaatgagc aatcgcggtt tgagcgtgtt agcagcctgg        60
     aagatctatc taaagctgct ggagagtcgc aactctagct acgcacaaac ccttatttcg       120
     caccggaagc tggtcgaagc catgtcgcta ccgacgcgcg atgtaaccgc cgggattgac       180
     cacttggtca accatagctt ggttcatgtc cggcagcatg acgtgctcgg atcagtgggg       240
     catccggtca atcagtacaa cctgctggga gaattccgtt ccaagccgat cactgtcagc       300
     attggcggtt tcccgatcag cactagagtc gcagagatgt ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page