(data stored in ACNUC9435 zone)

EMBL: AM039949.PE13

AM039949.PE13        Location/Qualifiers
FT   CDS_pept        complement(9414..10097)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0013"
FT                   /product="putative metal-binding protein, SEC-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19760"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19760.1"
FT                   /translation="MGAGHDAQLDRLGDFLEGVGAPAMNLEMLDGFFAALICGPETVLP
FT                   SEYLPQVFGEDHCFDSNDQAAEILGLVMRHWNTIASELFRTLEKDDVYLPVLLEDADGA
FT                   VHGNDWARGFMRGIQLRPNSWQELIGSEEFGGPMLPIMILTHEHDPDPAMRPPEIAPDK
FT                   RDELLQSLIAGLTHIYRYFASHRQLATQGPLRRQGPKIGRNDQCPCGSGRKYKHCCATS
FT                   APTFH"
     gtgggggcag gtcacgatgc ccagcttgat cggctgggcg actttctcga aggagtcggc        60
     gcacctgcaa tgaatctcga aatgctcgat gggttctttg ccgcactcat ttgtggtcca       120
     gaaacggttt tgcccagcga atacttgcca caagtattcg gggaagacca ttgcttcgac       180
     agcaatgacc aagccgccga aattcttggc ttggtcatgc ggcactggaa cacgattgca       240
     tcagaattgt tccgcactct ggagaaagac gatgtctacc ttcccgtgct actcgaagat       300
     gcggatgggg ccgtacacgg taacgactgg gcacgtggtt tcatgcgcgg cattcaatta       360
     cggcccaata gttggcaaga gttgatcggc agcgaagaat ttggcgggcc catgctgcca       420
     atcatgatct tgacccatga acatgatcct gatcccgcca tgcgcccgcc agagattgcg       480
     ccggacaaac gcgatgagtt gcttcagtcc ctgattgccg gactgacgca catctatcgc       540
     tactttgcct cacatcgcca attggcaacc caagggcctt tacgcagaca aggtcctaag       600
     attgggagaa atgatcagtg cccatgtggc agtgggcgga agtacaagca ttgctgtgct       660
     accagcgctc cgacatttca ttga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page