(data stored in ACNUC9435 zone)

EMBL: AM039949.PE2

AM039949.PE2         Location/Qualifiers
FT   CDS_pept        676..2916
FT                   /transl_table=11
FT                   /locus_tag="XCVb0002"
FT                   /product="DotA/TraY family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19749"
FT                   /db_xref="GOA:Q3C0G2"
FT                   /db_xref="InterPro:IPR027628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19749.1"
FT                   /translation="MLKSYGSTFPWAFGRAAAPEKWNPPADDSSLGILREVFGNIVDFV
FT                   IGNGVSAANLSENNTVIASGFEVFNTAILFLAMIFVAYSSIMGVINTAHDGEFLGRKMS
FT                   SIWVPLRTVGGSALLLPLAGGFSLIQIIILWLTLQGVGIGDKAWTAMLGRIDQSGMINH
FT                   PAIPNARPLVANILRSEVCMAAMNKQYAESDRTDRINLVEIKSSRTQMVPTDDLLGGTG
FT                   GNGLGLFGINYKSLTVPVTSWSWAASNGSYIRNDVCGGISWDESSESQAGNARYLDVAK
FT                   ISTAHTAAVRDVILAIRPVAASIVAGQKPNSDVILSTAYAYENKLRQAAKAAVDSGNKA
FT                   SRSAFVDYAKTGGWVFAGSYYNHIISLNDSVQLAVNSLPTSTSIDIQDKESQEALYGFR
FT                   DAMTVTEEFLKHRSQSAAAAYANETRLDTDACKSPTPTGWDEIRTCLSKPALAGIELMA
FT                   ANMTGSNTSHVAQVKAVGDTIMNVAWTQAGVFAIAGGVADAKLVDYSVGSFFSLKGALG
FT                   SVSVLVNTLVLSMLTAGIVLAFYVPMIPFITWTVGVIKWLVSVAEAMVAAPIFAAAHIH
FT                   PDGDEAVGRAGPGYTIILSTVLRPILMLFGLILSIAVAQPIAHFVNAGFMLAVKGSMHD
FT                   SANGLGAFVAYCVIYVIIMTTVLHSVFALIHWIPDNTMRWMGSAVGMGGVGDREEGESH
FT                   QVFAGAARQGRNLTTGPKAPPGGGRMGTEDGPEPPSGGTSESDHAQRPRGGG"
     atgctgaaaa gctacggctc tacctttcct tgggccttcg gaagggcagc agccccggag        60
     aaatggaatc ccccagctga cgactcttca ctcggcattc ttcgcgaagt gttcggcaat       120
     atcgtcgatt tcgtgattgg caatggcgtt agcgccgcca atttgagcga gaacaacacg       180
     gtcattgcct caggctttga ggtgttcaac accgcgatct tgttcctggc catgatcttc       240
     gtggcctaca gctcgatcat gggtgtgatc aacaccgccc acgacggcga attcctcggc       300
     cgcaagatgt cctcgatctg ggtgccacta cgcactgttg gcggcagtgc cttactgctt       360
     cctctggccg gcggcttctc actgatccag atcatcattc tctggctgac cctgcagggc       420
     gtaggcatcg gcgacaaagc gtggaccgcc atgctcggcc ggatcgacca gagcggaatg       480
     atcaatcacc cagcgatccc gaacgctcgt ccgctggtgg ccaacatctt gcgatccgag       540
     gtgtgcatgg cggcgatgaa caagcaatat gccgaatccg accgcacgga ccgcatcaac       600
     ctggtggaga taaaaagctc ccgcacgcaa atggttccca ccgatgacct tctcggtggc       660
     accggcggga acggactcgg cctcttcggt atcaactaca agtcgctcac cgtaccggtc       720
     acgagctgga gctgggcggc aagcaatggc tcctatatcc gcaatgacgt gtgtgggggc       780
     atcagctggg atgagagtag cgagtcgcaa gctggcaatg cccgctatct cgatgttgcc       840
     aagatcagca ctgcccacac cgccgccgtc cgcgatgtca ttctggccat tcgccctgtt       900
     gcggccagta ttgtcgctgg tcagaagccg aacagcgatg tgatcctcag caccgcctat       960
     gcctacgaaa acaagttgag gcaagcggcc aaggcggcgg ttgattccgg gaataaagcc      1020
     agccgcagtg cattcgttga ctacgccaag accgggggct gggtcttcgc cggcagctac      1080
     tacaaccaca tcatctcgct caacgacagc gtccaattgg cggtcaattc gcttccgacc      1140
     tccacctcaa tcgatatcca ggacaaggaa tcccaagaag ccctctatgg cttccgggat      1200
     gcaatgactg tcacagagga atttttgaag catcgctcgc agtctgcggc ggcggcctac      1260
     gccaacgaaa ctcgtttgga caccgatgcg tgtaagagcc cgactccgac gggctgggat      1320
     gagatccgca cgtgcctttc aaaacccgcg ctggctggca tcgagctgat ggcagccaac      1380
     atgactggca gtaacacgtc ccacgtcgct caggttaaag ctgtcggtga cacgatcatg      1440
     aatgtcgcct ggacgcaggc tggcgtcttt gcgatcgccg ggggcgtggc cgatgccaag      1500
     ctggtcgact attcggttgg ctcttttttc agcttgaaag gagcactggg aagcgtctcg      1560
     gtcctagtca acacgctggt cctgtccatg ttgactgccg gcatcgtctt ggcgttctac      1620
     gtgcccatga ttccgttcat tacctggacg gtcggcgtga ttaagtggct ggtctcggtc      1680
     gccgaagcga tggtggccgc gcctatcttc gctgccgcac acatccaccc tgatggcgat      1740
     gaagcggtgg ggcgagctgg acccggctac accatcatcc tgtcgaccgt cctgcgacct      1800
     atcctgatgc tgttcggcct aatcctctcg atcgcagtgg cgcagccaat tgctcacttc      1860
     gtcaatgccg gcttcatgct cgcggtgaag ggctcgatgc acgacagcgc gaatggactt      1920
     ggtgcgtttg tagcctactg cgtgatctac gtgatcatca tgaccacggt cctgcattca      1980
     gtttttgcgc taattcattg gatccccgac aacaccatgc gctggatggg cagcgcggtc      2040
     ggcatgggcg gcgttggcga cagagaggag ggcgaaagcc accaggtctt cgcgggcgca      2100
     gctcgccagg gccgcaacct gacaacgggg ccgaaagctc ctccgggcgg gggacgcatg      2160
     ggcactgagg acggcccaga gccacccagc ggcggtacca gcgagagcga tcacgcccag      2220
     cgcccacggg gcggcggtta g                                                2241
//

If you have problems or comments...

PBIL Back to PBIL home page