(data stored in ACNUC9435 zone)

EMBL: AM039949.PE20

AM039949.PE20        Location/Qualifiers
FT   CDS_pept        17896..18054
FT                   /transl_table=11
FT                   /locus_tag="XCVb0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19767"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19767.1"
FT                   /translation="MNQIMDACNSNAIRITLEWRALGDAANAPRYLASDLDALSWEDVR
FT                   ELGLQPA"
     atgaaccaaa tcatggacgc ctgtaacagc aatgcgatac gaatcacgct tgagtggcgt        60
     gcgttaggcg atgccgccaa tgccccccgc tacttggcct cagatcttga tgccctcagc       120
     tgggaagacg tcagagagct tggactgcaa cctgcctaa                              159
//

If you have problems or comments...

PBIL Back to PBIL home page