(data stored in ACNUC9435 zone)

EMBL: AM039949.PE22

AM039949.PE22        Location/Qualifiers
FT   CDS_pept        18805..19059
FT                   /transl_table=11
FT                   /locus_tag="XCVb0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19769"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19769.1"
FT                   /translation="MATKKTADLSGLVATKGAAAPVAGMPVRAPAPRSDDTEVANNEPL
FT                   NFRVSGDFRRRFRMFAAAHDMKLNELLRLVFEEYEKKHG"
     atggccacca agaaaactgc cgacctgtcg ggccttgtgg ccacaaaggg cgccgccgcc        60
     cccgttgctg ggatgccggt acgggcgccg gcgccgcgct ccgacgacac cgaggtggcc       120
     aacaatgagc cactgaactt ccgggtttct ggcgacttcc gccggcgctt tcgcatgttt       180
     gccgccgctc atgacatgaa gctcaacgag ttgttacgcc tggtctttga ggaatacgag       240
     aagaagcacg gctaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page