(data stored in ACNUC9435 zone)

EMBL: AM039949.PE3

AM039949.PE3         Location/Qualifiers
FT   CDS_pept        complement(3106..3699)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19750"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19750.1"
FT                   /translation="MAPSANTRWPQGTALRTEYFPPVVVKGQRVDLSHLDPLTITFESL
FT                   KVGKALRVAVTFTNHCFSASYGEIPHPPGDAVIWDGRKMRTFCPTRYRLSKVLPDLIRS
FT                   MPEKKVILAAHETTWVHTLTIEDPSGPYHLFLTVKRSSREKRTWQDVDVIVESAYHETR
FT                   NAPTTTGSWRPFVVVCGEAYLANPHKPNKRRHRR"
     atggcgccat cggccaatac tcgatggcca caaggaacgg cattgagaac ggagtatttc        60
     ccgccggtag tggtcaaagg tcaacgggtc gacctgtcgc atctagaccc gctgacaatc       120
     accttcgaaa gcctgaaggt gggcaaggcc ttgagggtgg ctgttacctt taccaaccac       180
     tgtttcagcg cctcgtatgg agagatcccg cacccgccag gtgatgcggt aatttgggat       240
     gggaggaaga tgcggacctt ctgcccgacg cgctatcggc tctctaaggt gttgccggat       300
     ctgatccgct caatgccgga gaaaaaagtg attctcgcgg cgcatgaaac aacgtgggtc       360
     cacaccctga cgatcgagga tcccagcggg ccctaccacc tgtttctgac ggtcaagcgc       420
     agttccaggg agaagcgcac ctggcaggac gtcgatgtta tcgtggaaag cgcgtaccac       480
     gagacgcgca acgcgccgac caccacaggc agttggcggc cttttgtggt cgtatgcggt       540
     gaggcctatc tggccaatcc tcacaagccc aacaagcggc gccacaggcg gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page