(data stored in ACNUC9435 zone)

EMBL: AM039949.PE4

AM039949.PE4         Location/Qualifiers
FT   CDS_pept        complement(3762..4280)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19751"
FT                   /db_xref="GOA:Q3C0G0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19751.1"
FT                   /translation="MRFFLDTEWADPVGSELVSIGLVSEDSHHRFYAERDPLPAMPTDF
FT                   VRHVVYPILQGKPASMSEMAMTTGLRVFLGADQAPLVLADYAHDLVLLRYVLAGFDMPD
FT                   DQAQECGPIPQVQGLLIDGDQIDRKVEWLFENRPMLRARRHHALNDAEALRMAWKLCRA
FT                   EQALDKTGD"
     atgcgcttct ttctcgatac ggaatgggct gatccagtgg gatccgagct ggtgagcatt        60
     gggctcgtga gcgaggatag ccatcaccgt ttctatgccg agcgagatcc actgccggcg       120
     atgccaaccg actttgtacg gcatgtggtc tacccgatct tgcagggtaa accggcctcg       180
     atgtcggaga tggccatgac caccggcctg cgcgtcttcc tgggcgctga ccaggcccca       240
     ctggtactgg cagactatgc ccatgacctg gtgctgctgc gctacgtgct ggccggcttc       300
     gatatgccgg acgatcaggc gcaggagtgc ggtccaatcc cccaggtgca gggcctgctg       360
     atcgacggtg accagatcga ccggaaggtc gagtggctgt tcgagaaccg tccgatgctc       420
     cgggcgcgcc ggcatcatgc gttgaatgat gctgaggcac tgcgcatggc gtggaagctg       480
     tgcagggcag agcaggctct ggacaagaca ggcgactga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page