(data stored in ACNUC9435 zone)

EMBL: AM039949.PE5

AM039949.PE5         Location/Qualifiers
FT   CDS_pept        complement(4605..4997)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19752"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19752.1"
FT                   /translation="MSSWSKNAHPPGCASSGDAGLQPGVACPKPSKKETKMSTEKRNTR
FT                   LTDFTQNDADDDLVLQVCDALEAIVVRLQLRAGAALAAVRSGTLGIEPRRAYDYLLGVF
FT                   HALVFRGEINEDSWWEIDAELDRLAV"
     gtgtctagct ggtccaaaaa cgcgcatcca cctgggtgcg cttctagtgg cgacgccggg        60
     ttgcagcccg gcgtcgcctg cccaaagccg tctaagaagg agacgaagat gagcactgaa       120
     aagcgtaaca ctcgcctgac tgactttact cagaacgacg ctgatgatga cctggttttg       180
     caagtgtgcg atgccctgga agcgattgtc gtcaggctgc agctgcgtgc gggggctgcg       240
     ttggcggccg tgcggtcagg cactctaggc atcgagccac gccgcgccta cgactacctg       300
     ctaggcgtct tccatgccct ggtgttccgc ggggaaatca atgaagacag ctggtgggaa       360
     atcgacgctg agctcgatcg attggccgtc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page