(data stored in ACNUC9435 zone)

EMBL: AM039949.PE7

AM039949.PE7         Location/Qualifiers
FT   CDS_pept        complement(5202..5570)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19754"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19754.1"
FT                   /translation="MPMSQADYQRGLDDQRFYFQQRLNRLIELRDRWIVHARGETARAD
FT                   RLSHELAKAQKHSQASTQQIASLQTKLAAAERTLADLQATSAQRITSLERELEQATENY
FT                   GWIVSVVEDHGVQLRSQP"
     gtgcccatgt cgcaagctga ctatcaacga ggcctcgacg accagaggtt ctactttcag        60
     cagcgcctca atcgactcat cgagcttcgc gaccgttgga tcgtccatgc ccgaggcgaa       120
     acggcgcggg ctgatcgcct gagccatgag ctggccaaag cgcagaagca cagccaggct       180
     tccactcaac agattgcctc gcttcaaacg aagctggcgg cggccgagcg cacgctcgcc       240
     gatctgcaag ccacctctgc tcagcgcatc acgagtctgg agcgcgagct agagcaggcg       300
     accgagaact acgggtggat cgtcagcgtg gttgaggacc atggtgtcca gctgaggtcg       360
     cagccataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page