(data stored in ACNUC9435 zone)

EMBL: AM039949.PE8

AM039949.PE8         Location/Qualifiers
FT   CDS_pept        complement(5616..7217)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0008"
FT                   /product="MobA/MobL family plasmid mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19755"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19755.1"
FT                   /translation="MCGPTGKSEEQKVSVAIFHLCAKVIGRSAGRSATAAAAYRSGTEV
FT                   VDMRTGEVHDYSRRGGVRETFILAPVGSGEWVSDRSALWNAVEAAEKRKDAQLCREVEV
FT                   SLPHELSHDERRRLLVEFCEAEFVALGMVADVAMHSPGHEGDKRNEHAHIMLTMRRVEG
FT                   QGFGQKAREWNSKDLVEQWRSGWAERVNVRLAEHAIQATVDHRSYVRQALAAGHDVESA
FT                   AAPTVHLGPKASAMERRGEQTELGNQNRKVIAFNAQRKVLRRELGQVSAQIIDLEKARS
FT                   DRAARSVVPPRSGVQVRAPRRLGESREAREMREAAERVTEVLMTLLGLGEPPTSHQVRA
FT                   EISRRRPAPMNIRPSGAVLETQALLQVIESKLAKVENRNRALNEDVAKYRDFVALDERV
FT                   AAWREAHPYRARMHDLGVARTDEAEFCGHDLQAAKGRIAELQKELRDEYASLGKAKEEQ
FT                   TVYLAQLQGQAAAQALTSGAPATVELIEQLEQHAAVLEAYERSIAEAAAQVAETAADDK
FT                   NLDDQPDIEHPRPSIN"
     gtgtgcggcc ctacgggcaa aagcgaagag cagaaggtat ctgtggccat atttcatctc        60
     tgtgcgaagg ttatcggtcg gtcggcgggt cgttccgcta ctgcggccgc ggcttatcgc       120
     tcggggactg aagtggtcga tatgcgcact ggtgaggttc acgactactc tcgccgtggt       180
     ggtgttcgtg agacttttat tttggcaccc gtgggttcgg gcgaatgggt ttctgacagg       240
     tcggcgcttt ggaatgccgt agaggccgct gagaagcgca aggatgctca gctatgccga       300
     gaggtggagg tcagccttcc gcatgaactc agccatgatg agcgccgccg tctgttggtc       360
     gagttttgtg aggcggaatt tgtggcattg gggatggtcg ctgatgtggc catgcactca       420
     cctggtcacg aaggcgacaa gcggaatgag catgctcata tcatgctgac catgcgccgg       480
     gttgaggggc agggcttcgg ccaaaaggcg cgggaatgga actccaagga tcttgtcgaa       540
     cagtggcgtt ccgggtgggc tgagagagtg aacgtgcgac ttgctgagca cgcaattcaa       600
     gcgacagtgg atcaccggag ctatgttcgc caggcgctcg ccgctggtca tgatgttgaa       660
     tcggctgcgg ctccaaccgt tcaccttggg ccgaaagcat cggccatgga acggcgaggt       720
     gagcagactg aattgggtaa tcagaaccgg aaggtgattg ccttcaacgc tcagcggaaa       780
     gtcctccgac gcgagcttgg ccaggtatcg gctcagatta tcgacctgga aaaggcgcgc       840
     tctgatcgag cggccagatc ggttgtccct cctcgctcag gcgtgcaggt ccgtgcaccg       900
     cgccgtcttg gcgaaagccg tgaggcccga gagatgcggg aggccgcgga gcgtgtaacg       960
     gaagtgctca tgaccctgtt gggtctgggt gagccgccga cgtcgcacca ggtgcgcgca      1020
     gagatttccc gtcgtcgtcc ggctccgatg aatattcgcc cgtctggtgc ggtactagag      1080
     acgcaggcgc tgctccaggt gatcgaatcg aagctggcca aggtcgagaa tcgaaatcgc      1140
     gccctcaatg aggatgtcgc gaagtaccgg gattttgttg ctctggatga acgcgtagct      1200
     gcatggcgcg aagcccaccc ctatagggcg aggatgcacg acctgggcgt ggctcgtacc      1260
     gacgaggccg aattctgtgg ccatgatctg caagcggcga aggggcggat tgccgagctg      1320
     cagaaggagc tcagagatga gtacgcttcg ctgggcaagg ccaaggaaga gcagacggtt      1380
     tatctggcac aactacaggg gcaggctgca gcccaggcgc tgaccagcgg cgcccctgcg      1440
     actgtggagc tgatcgagca gttggagcag cacgcggcgg tgttggaggc ctacgaacga      1500
     tctattgctg aggctgcagc acaagtggca gagacggctg ccgatgacaa gaatctggat      1560
     gaccagcccg atattgagca cccacgccca tcaatcaatt ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page