(data stored in ACNUC9435 zone)

EMBL: AM039949.REP

AM039949.REP         Location/Qualifiers
FT   CDS_pept        17396..17899
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="XCVb0019"
FT                   /product="Replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19766"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19766.1"
FT                   /translation="MSLPVPSSKKRIEYVQLYRSSMKALRQLALEAPTAHAVLYVLMER
FT                   INERNALVASYATLAKLTGKSRATITRALAELRTRNYIEMVKAGNVSVIVVNKRVAWAT
FT                   ETALRGKLAVFDARVIVSSEEQDEPERLGKEPDLVRLPPVLVPPEMATMLEDGEDDGQG
FT                   DLQL"
     atgagcctcc ccgtgcccag ttccaagaag cggatcgagt acgtccagct ctatcgatca        60
     tcgatgaaag ccctcagaca gctggcccta gaagcgccta cggcgcacgc cgtgctgtac       120
     gtactgatgg agcgaatcaa tgagagaaac gccctggtag ccagctacgc cacactggca       180
     aagttgaccg gcaagtcccg ggcaacgatc actcgagctc tagcagagct gcgcactcgc       240
     aactacatcg agatggtgaa ggcgggcaac gtgtctgtga tcgtggtgaa caagcgcgtg       300
     gcttgggcca cagagacggc cttgcgcggg aagctggcag tatttgatgc tcgcgtcatc       360
     gtgtcctccg aagagcagga cgagcccgaa aggcttggca aagaaccaga cctagttagg       420
     cttccccctg tgcttgttcc acctgagatg gccaccatgc ttgaagatgg tgaagacgat       480
     ggccaaggtg atttgcagct atga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page