(data stored in ACNUC9435 zone)

EMBL: AM039950.KFRA

AM039950.KFRA        Location/Qualifiers
FT   CDS_pept        4935..5621
FT                   /transl_table=11
FT                   /gene="kfrA"
FT                   /locus_tag="XCVc0007"
FT                   /product="KfrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19776"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19776.1"
FT                   /translation="MDPSQDARDRILTAADSLYDQAGREVFPTVDAVRKAAKVNMNDAS
FT                   TVMKEWRRMQTRPAVVVQVPEAVQQVASTAVLALWQAAQDAANDALRAAQAGWEAERQE
FT                   ADALSQQMADAYEAQALELEAAQARIAELEAAMQQAVTAAAAHQAAIDQVRTELVDLQQ
FT                   RASTAEARASELRTELDRAHLVAAEQRSAAGQAREDAATLRGRLAAFEGMATSPAPVKA
FT                   APGKGM"
     atggacccgt cccaagacgc acgtgatcgc atccttacag ccgctgactc gctgtatgac        60
     caggccgggc gtgaggtttt tccaaccgtc gatgccgtgc ggaaggcggc caaggtcaac       120
     atgaacgacg caagcaccgt catgaaggag tggcggcgca tgcagacccg cccagcagtg       180
     gtggtgcagg tgcccgaggc ggtacagcag gtcgccagca cggccgtgct ggcgctgtgg       240
     caggccgccc aggacgccgc caatgacgca ctgcgtgccg cccaggctgg ctgggaagca       300
     gagcgacagg aagcggatgc gttgagccag cagatggccg acgcctacga agcccaagca       360
     cttgagctag aagcggccca agcacgcatt gccgagctgg aagcggccat gcagcaggcc       420
     gtcacggcag cggccgccca ccaggccgcg atcgaccagg tgcgcaccga gctggtggac       480
     ctacagcagc gggccagcac ggctgaggcc cgcgccagcg agctacgcac cgagctggat       540
     cgggcgcacc tggtcgccgc cgagcagcgt tccgctgccg gccaggcccg tgaggacgcc       600
     gcgactttgc gcggtcgctt ggccgctttc gaggggatgg ccacctcgcc cgccccagtc       660
     aaagccgccc ccggcaaggg gatgtaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page