(data stored in ACNUC9435 zone)

EMBL: AM039950.PE1

AM039950.PE1         Location/Qualifiers
FT   CDS_pept        1242..2060
FT                   /transl_table=11
FT                   /locus_tag="XCVc0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19770.1"
FT                   /translation="MPAVDTGPHAQGPEPTAPSGRPHKRVHWRQPKPLAGKKRRPGVLD
FT                   ATRHGLVRALEERKGAWKRIRHNVIVAGYALDKALTRVRGLRKDGADSLLAMAVALLYL
FT                   ADVRTGFVGKPRQGGGPWQRYTLPDLAQLAYGGQSDAEQRRARRSLDMMVSLGWAFPTK
FT                   QVRRHTKDADGGDLWCSEAGVRRLNFQRLCDMVGTSRLLKRDRKHADQARGTGVASFTQ
FT                   AQARRQPTQESRTTSRRRDTRPAAHRATGAPPGDAQSAVRHISDILALFN"
     atgccagcag tagacacagg cccccacgct caaggcccag aaccgaccgc tcccagcggc        60
     aggccgcaca agcgtgtgca ctggcgtcag cccaagccgc tggccggcaa gaagcgccgg       120
     ccgggcgtac tggacgctac tcgccatgga ctggtgcgcg ccctggaaga acggaaaggc       180
     gcgtggaagc ggattcgcca caacgtcatc gtggccggtt atgccctgga caaggcgctg       240
     acgcgggtgc gcggactgcg caaggatggg gccgactcgt tgttggccat ggccgtagcg       300
     ctgctctacc tggccgacgt gcgcaccggc tttgtgggca agccacgcca gggcggcggc       360
     ccctggcagc gctacacgct gcccgacctt gctcagctcg cctatggcgg acagagcgac       420
     gccgagcagc ggcgcgcacg gcgctcgctc gacatgatgg tgagccttgg ctgggcattc       480
     cccaccaaac aggtgcggcg gcacaccaaa gacgccgatg gcggcgacct gtggtgcagt       540
     gaggcgggcg tgcgccggct caacttccag cggctgtgcg acatggtggg gacgagcaga       600
     ttgctcaagc gcgatcgcaa gcacgccgac caagcacgcg gcacaggcgt tgcgtccttt       660
     acgcaggcgc aagcacgccg tcagccgacc caggagtcgc gcaccacgtc gcgcaggcgc       720
     gatacccgcc ctgcggcgca ccgcgccacg ggcgccccgc caggcgacgc acagagcgcc       780
     gtgaggcaca tttccgacat cctcgccctg ttcaactag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page