(data stored in ACNUC9435 zone)

EMBL: AM039950.PE13

AM039950.PE13        Location/Qualifiers
FT   CDS_pept        complement(10402..11088)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0013"
FT                   /product="putative plasmid stable inheritance protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19782"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19782.1"
FT                   /translation="MKVAVISFSGNPGKTTLVDHLLAPRMNAPKFEIETINAGSSADTD
FT                   AQRFKGKDYGGLQEDLMTLDSAIVDVGASNVEEFIKQMGQFEGSHEEFDYYVVPTVSEK
FT                   KQQADTLSTIRTLTSLGVPAKKIRVVFNKVELEDANDVPRLFRMIFGLHEETKSFTLRP
FT                   EAVVFKNEIFDRLRTLKKTVSEIVADETDYRAMLREAKDEDAKAHAINMISAGNPPTFS
FT                   GRQKWS"
     atgaaagttg ccgtcattag tttcagtgga aacccgggga agaccacgct ggttgatcac        60
     ctgcttgcgc cgcgtatgaa cgcaccgaaa ttcgagattg agacgatcaa tgccggatca       120
     tcagcggaca ccgacgcaca gcgcttcaag ggcaaggact acggcgggct gcaagaggac       180
     ctgatgacac tcgattcggc catcgtggac gtgggtgcat ccaacgtcga agagttcatc       240
     aagcagatgg gccagttcga ggggtcccac gaagagttcg actactacgt cgttccgacc       300
     gttagcgaga agaagcagca agccgatacg ctaagtacta tcaggacact caccagcctc       360
     ggcgtgccgg cgaaaaaaat ccgcgtggtg ttcaacaagg tcgagctgga agacgccaac       420
     gacgtgccgc gcctgtttcg gatgatcttt ggcctgcacg aagaaaccaa gagcttcacg       480
     ctgcgaccag aagccgtggt attcaagaac gagattttcg accggctgcg gacgctgaaa       540
     aagaccgtct cggaaatcgt ggccgatgaa acggactatc gggcaatgct tcgtgaagcc       600
     aaggacgagg acgccaaggc gcacgcgatc aacatgatct cggcgggtaa tccccccact       660
     tttagcggtc gccagaagtg gagctaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page