(data stored in ACNUC9435 zone)

EMBL: AM039950.PE14

AM039950.PE14        Location/Qualifiers
FT   CDS_pept        complement(11085..11540)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0014"
FT                   /product="putative TraD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19783.1"
FT                   /translation="MTKPDAKQAVRQTEPTTKAAQLREVMPEIEKKLAAGVQLRTIHKA
FT                   LTDAGFDLTFQTLKTYLYRYRKKHQAKTVRQQTESVGSRSAGTPTPASSQSDESVSDET
FT                   YSSEPPTPRGPISMQELDRLMKPDPAKQAQDIARYERLAKQKERSRK"
     atgacgaagc cagacgcaaa acaggcagtc aggcagacgg aaccgaccac caaagcggcg        60
     caattacggg aagtgatgcc ggagatcgag aagaagctcg cagcaggtgt gcagctccgg       120
     acgattcaca aagcgttgac cgatgccggt ttcgacctga cgtttcagac gctcaagacg       180
     tacctgtacc gataccgaaa gaagcatcaa gcaaagaccg tgagacagca gacggagtct       240
     gttggctcac ggtcggctgg cacaccgacg ccggcatcat cccaatccga cgaatctgtt       300
     tcagacgaaa catattcgtc ggaaccgcct acaccgcgtg gcccgatctc gatgcaggag       360
     cttgaccgcc tgatgaaacc cgacccggca aaacaggcac aggacatcgc gcgatatgag       420
     cgcttggcca agcagaaaga aaggagccgc aaatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page